[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF67784.1

[Show Plain Result]


## Summary of Sequence Search
    1::242
    1::123     2e-17  43%  123 aa  PF00005 ABC_tran "ABC transporter"
    1::242

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSSLLRVLNLLEMPRSGTLTIAGNHFDFTK
PF00005         -----------------------------------------STLLRLLAGLLKPTSGKILLDG-------


                         .         .         *         .         .         .         .:140
query           TPSDKAIRELRQNVGMVFQQYNLWPHLTVVQNLIEAPCRVLGLTKDQXXXXXXXXXXXXXXXPYSDRYPL
PF00005         VISPLELRKLR--IGYVFQDPALFPHLTVRENILKNDEKLKEIKKKEAKEEILEALERVGLLKFLYRYPH


                         +         .         .         .         .         *         .:210
query           HLSGGQQQRVAIARALMMEPQVLLFDEPTAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         ELSGGQRQRVAIARALIKEPKVLLLDEPTS----------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00005         --------------------------------