[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF67908.1

[Show Plain Result]


## Summary of Sequence Search
    1::406
   50::181     7e-28  44%  181 aa  PF00480 ROK "ROK family"
    1::406

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00480         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00480         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xKLERLTSIAITLPGIIDTENGVVHRMPYYEDVKEMPLGDALERHTGVPVYIQHDISAWTMAEALFGASR
PF00480         -ELGRVLGIGIGVPGPVDPETGGVVSAPN-PGWRNVPLKEELEERLGLPVFVENDANAAALAEAWFGAGR


                         .         .         .         +         .         .         .:280
query           GARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSVxxxxxx
PF00480         GADDVVYVTLGTGVGGGIVINGRLLRGANGNAGEIGHMPVDPDGPPCGCGNRGCLETYASGTAV------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00480         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00480         --------------------------------------------------------