[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF68005.1

[Show Plain Result]


## Summary of Sequence Search
    1::166
    6::142     2e-33  46%  142 aa  PF01257 Complex1_24kDa "Respiratory-chain NADH dehydrogenase 24 Kd
    1::166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxYEDPRAASIEALKIVQKQRGWVPDGAIYAIADVLGIPASDVE
PF01257         ----------------------------YPRKRSALIPLLHLAQDQFGYLPDEAIEAIAEYLGLPPAEVY


                         .         .         *         .         .         .         .:140
query           GVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKNLNIKPGQTTFDGRFTLLPTCCLGNCDKG
PF01257         EVATFYSMFRRKPVGKHHIRVCTGTSCALRGSEELLEALEEKLGIKPGETTLDGKVTLEEVGCLGACDNA


                         +         .         .         .         .         *         .:210
query           PNMMIDEDTHSHLTPEAIPELLERYx
PF01257         PVVMVNDDYYEKVTPEDVDEILEEH-