[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF68113.1

[Show Plain Result]


## Summary of Sequence Search
    1::385
   58::98      8e-05  54%  384 aa  PF01053 Cys_Met_Meta_PP "Cys/Met metabolism PLP-dependent enzyme"
   67::196     2e-04  34%  368 aa  PF01276 OKR_DC_1 "Orn/Lys/Arg decarboxylase, major domain"
    1::385

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01053         ----------------------------------------------------------------------
PF01276         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
PF01053         -----------------ALEERLAALEGGEAALAFASGMAAITAALLALLKAGDHIVA------------
PF01276         -------------------QELAARVFGADKTYFVVNGTSSNKAVIMALVGPGDKVLVDRNCHKSVIHAL


                         +         .         .         .         .         *         .:210
query           NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGxx
PF01053         ----------------------------------------------------------------------
PF01276         ILSPESIRKAIAENPDAKARL---------AVITNPTY--DGVCYDLEQIVDLLHKLGDPLLVDEAHG--


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01053         ----------------------------------------------------------------------
PF01276         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01053         ----------------------------------------------------------------------
PF01276         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01053         -----------------------------------
PF01276         -----------------------------------