[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF68332.1

[Show Plain Result]


## Summary of Sequence Search
    1::429
    6::273     3e-17  32%  347 aa  PF07690 MFS_1 "Major Facilitator Superfamily"
  141::358     8e-04  28%  560 aa  PF03137 OATP "Organic Anion Transporter Polypeptide (OATP) family"
    1::429

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxYVLAFLDRSNIGFAKETYQIDTGLSNEAYALGAGIFFVVYAFLGVP
PF07690         ------------------------YFLSGLDRSILSPALPALAEDLGLSPSQVGLLLSAFLLGYALGSPP
PF03137         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ANLLMRKFGARTWIGTTTLLWGFLSAAMAWADSEAKFLIIRTLLGAAEAGFFPGMIYLTSQWFPQRNRAS
PF07690         AGPLADRFGRRRVLLLGLLLFALGSLLLAFASNSWLLLVARFLQGLGAGGLFPAASALIADWFPPEERGR
PF03137         ------------------------------------FFLAQLLLGIGATPLYTGITYLDDN-VKKKNSPL


                         +         .         .         .         .         *         .:210
query           IMGLFYMGAPLALTLGSPLSGALLEMHGFMGHPGWFWMFVIEGLLAIGAGIFTFFWLDDTPQQARFLSLE
PF07690         ALGIFSAGGGLGAALGPLLGGLLAE------SLGWRWAFLILAILGLLALLLALLLLPEPPPEAKRLSPA
PF03137         YLGILYSLRMLGPAIGFLLGSFLLKIYVDPGKPGWWLGFLILGALLLLVAIPLFFFPKELP-KAKKESLS


                         .         .         .         +         .         .         .:280
query           EKNALIRQLASEEEKKVTSRLADALRNGRVWQLAIIYLTIQVAVYGLIFFLPTQVAALLGTKVGFTASVV
PF07690         EK-------LLERAPSPLLPLKLLLKNPVLWLLLLALFLFGFGFYGLLTFLPLYLQEVLGFS-ALQAGLL
PF03137         ERKTEDEELKAAEEEKSGKGLGKSLKDNPVYMFNTLAGVFELGVSGFATFLPKYLETQFGSSASFLTGLI


                         .         *         .         .         .         .         +:350
query           TAVPWVAALLGTWLIPRYSDRTGDRRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         LALGGLVGAIGSLLGGRLSDRLGPRR--------------------------------------------
PF03137         T-VPGAAVLLGGLIIKKF----------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF07690         ----------------------------------------------------------------------
PF03137         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxx
PF07690         ---------
PF03137         ---------