[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF68340.1

[Show Plain Result]


## Summary of Sequence Search
    1::172
    6::152     2e-20  45%  152 aa  PF00419 Fimbrial "Fimbrial protein"
    1::172

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxSGTITDNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFA
PF00419         ---------------------------TGTVVDATCTVNTGSKDQTVDLGTVSASDLSAAGDTSGPKPFT


                         .         .         *         .         .         .         .:140
query           IDLQNCGSTASGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQAS
PF00419         IKLTNCPATTSKVKVTFSGTADTTNNNLLALTATSGAATGVGIQLLDADGTPIKLNGATVSTVTLLANGS


                         +         .         .         .         .         *         .:210
query           AHLQFYARYLADGGAVTPGDANASATFILAYE
PF00419         ATLPFTARYVATGAAVTAGKVNATATFTVTYQ