[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF68462.1

[Show Plain Result]


## Summary of Sequence Search
    1::305
    1::125     3e-18  37%  125 aa  PF08546 ApbA_C "Ketopantoate reductase PanE/ApbA C terminal"
   17::145     5e-18  37%  150 aa  PF02558 ApbA "Ketopantoate reductase PanE/ApbA"
    1::305

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxLLEAGHDVTLIDGWQEHVDAIRSKGLFVETETTQKYYPIPAMLADESQGEFE
PF08546         ----------------------------------------------------------------------
PF02558         ------------------LARAGHDVTLV-ARGAHLEALRENGLRLRSDGGETTVPPPAATDPEAAGPID


                         .         .         *         .         .         .         .:140
query           LVILFTKAMQLDSMLQRIKPLLPAAKVVMILSNGLGNIETLEKYVDRQKIYAGVTLWSSELEGAGHIMAT
PF08546         ----------------------------------------------------------------------
PF02558         LVIVAVKAYQLEAALASLAPLLGPDTTILLLQNGMGHEEELAEAFPRPRVLGGVTTHGATLEGPGVVRHT


                         +         .         .         .         .         *         .:210
query           GTGTIELxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDVLLSIWKKAAFNSVMNTYCALLDCNVGGFGQRP
PF08546         ------------------------------------DIRAARWEKLVVNAAINPLTALTGCPNGELLADP
PF02558         GAGRLIL---------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GALDLAQAVVDEFVLVAASQNIPLTEQMVMNTVKKVFDPRESGHHYPSMHQDLHKGRLTEIDYLNGAIAR
PF08546         GARALIRALMDEALAVARAAGVELSEDRLEEEVERVI--RATAANKSSMLQDLEAGRPTEIDYINGYVVR
PF02558         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IGAQNNIAVPVNKLLTQLIHAKExx
PF08546         LARALGVPTPVNETLYALVKAKE--
PF02558         -------------------------