[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF68510.1

[Show Plain Result]


## Summary of Sequence Search
    1::555
    1::186     6e-63  64%  186 aa  PF03950 tRNA-synt_1c_C "tRNA synthetases class I (E and Q),
    2::282     6e-41  40%  309 aa  PF00749 tRNA-synt_1c "tRNA synthetases class I (E and Q), catalytic
    1::555

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYQGQCNLRFDDTN
PF03950         ----------------------------------------------------------------------
PF00749         ---------------------------VRTRFAPSPTGYLHIGHARTALLNYLFARAHGGKFLLRIEDTD


                         .         .         *         .         .         .         .:140
query           PVKEDIEYVDSIKNDVEWLGFHWSGDIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAP
PF03950         ----------------------------------------------------------------------
PF00749         PEREVPEAEDAILEDLEWLGLDWDGGPYRQSERFDIYYEAAEQLIEKGLAYPCFCTREELEALRGAQEAK


                         +         .         .         .         .         *         .:210
query           GKNSPFRDRSVEENLALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYP
PF03950         ----------------------------------------------------------------------
PF00749         G---PERPRYDGECRDLFEEMRAGEAAGGPAVLRLKIPMASP-IAFRDLVRGRITF-DPSELGDRSDGYP


                         .         .         .         +         .         .         .:280
query           MYDFTHCISDALEGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTD
PF03950         ----------------------------------------------------------------------
PF00749         TYHLAVVVDDALMGITHVIRGEDLLDSTPRQILLYEALGWPPPPYAHLPLILNPDGKKLSKRKGATLI--


                         .         *         .         .         .         .         +:350
query           KHVEGWDDPRMPTISGLRRRGYTAASIREFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAPRAMAVIDPV
PF03950         -----------------------------------------------------------APRYMAVLDPL
PF00749         GQYRGWGDPPEATLNYLARLGWSPEAIREF----------------------------------------


                         .         .         .         .         *         .         .:420
query           KLVIENYPQGESEMVTMPNHPNKPEMGSREVPFSGEIWIDRADFREEANKQYKRLVMGKEVRLRNAYVIK
PF03950         KVVITNYPEGQEEELEAPNHPKNPEMGTREVPFSREIYIEREDFREEPPKKYKRLAPGKEVRLRYAYNIK
PF00749         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIHWVSAAHALPIEIRLYDRLFSVPNPGAAEDFL
PF03950         CTEVEKDEDGNVTELHCTYDPDTLS----GARKVKGVIHWVSASDAVPAEVRLYDRLFTKENPEAEDDDF
PF00749         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SVINPESLVIKQGYGEPSLKAAVAGKAFQFEREGYFCLDxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03950         -LLNPDSLVIKNAYVEPSLADAKPGDRFQFERIGYFRVD--------------------------
PF00749         -----------------------------------------------------------------