[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF68527.1

[Show Plain Result]


## Summary of Sequence Search
    1::722
    1::35      9e-05  49%   36 aa  PF08238 Sel1 "Sel1 repeat"
  102::170     1e-04  37%  200 aa  PF09318 DUF1975 "Domain of unknown function (DUF1975)"
  145::226     2e-04  34%  353 aa  PF03268 DUF267 "Caenorhabditis protein of unknown function, DUF267"
    1::722

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08238         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF03268         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08238         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF03268         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08238         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF03268         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08238         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF03268         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08238         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF03268         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGKPASS
PF08238         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF03268         ----------------------------------------------------------------GKTISS


                         .         .         +         .         .         .         .:490
query           KMYKHDVLDGDFEKWYENGHRESVYPYKNGMLNGDAKHWNEQGKLTYTTEYKDDKKQGADRRWSERTGKL
PF08238         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------DNGQLRAKIHYSDETKRL
PF03268         WYYIFDPFI-NFLCWYISFLCLAIYALVNTALNREIEYFNEE--LENAKEEKTLKNPGVLQKFSFRQIEL


                         *         .         .         .         .         +         .:560
query           VEEVMFANDERNGLKREFNDRTGKVLSALPYVDGDKEGTEEAYDEDGIKYIxxxxxxxxxxxxxxxxxxx
PF08238         ----------------------------------------------------------------------
PF09318         VKYVEYFDDNGRLIRRDFYDDRG-FLSATTYYDDDKLILEEYYNPDGKEVI-------------------
PF03268         IELVNFANE-------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08238         ----------------------------------------------------------------------
PF09318         ----------------------------------------------------------------------
PF03268         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxSDAQLEVGYLNLIGEGMPKNLPEAYKWIKKSADQGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF08238         -----SEAQYNLGYMYLNGLGVPKDYEKALKWYRKAAEQG------------------------------
PF09318         ----------------------------------------------------------------------
PF03268         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxx
PF08238         ----------------------
PF09318         ----------------------
PF03268         ----------------------