[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF68589.1

[Show Plain Result]


## Summary of Sequence Search
    1::157
    1::146     8e-49  72%  147 aa  PF07295 DUF1451 "Protein of unknown function (DUF1451)"
    1::157

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxELVASLSERLRNGERDIDALVEQARQRVMQTGELTRTEVDELTRAVRRDLEEFAMSYEESQ
PF07295         ---------EYLASLSERLKNSERDLDKAVEQAKERLIAAGELTREELALLSAYLRRDLEEFARSYEEDE


                         .         .         *         .         .         .         .:140
query           EDSVFLRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCEKCHYHLAVYTPDVLP
PF07295         EDSVFLRLIEESLWQELLSITDKTQLEWRELFQDLEHHGVYHSGEVVGLGTLVCEKCGHELHFYHPEVLP


                         +         .         .         .         .         *         .:210
query           LCPKCGHDQFQRRPxxx
PF07295         PCPKCGHDEFTRRP---