[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF68745.1

[Show Plain Result]


## Summary of Sequence Search
    1::408
    1::109     2e-15  43%  312 aa  PF06767 Sif "Sif protein"
   19::128     4e-05  33%  229 aa  PF11047 SopD "Salmonella outer protein D"
    1::153     1e-04  31%  201 aa  PF00657 Lipase_GDSL "GDSL-like Lipase/Acylhydrolase"
    1::408

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPLSVGQGYFTSFISSEKFNAIKESARLPELSLWEKIKAYFFTTHHAEALECIFNLYHHQELNLTPVQVR
PF06767         MPITIGNGFLKSEIFSESPNNTKESWWK---SLWEKIKDFFFSTGRAKADQCIHEL-CFADSPPTRERLR
PF11047         -------------------SADKEEAT--HMGLWDKIKDHFRGEKKDEALEVLYSLIHGQEVNVEDMEKI
PF00657         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GAYIKLRALASQGCKEQFIIESQEHADKLIIKDDNGENILSIEVECxxxxxxxxxxxxxxxxxxxxxxxx
PF06767         DIFFKLKELASPSCRDRFQVENQHENDATIIMDENGEDEL------------------------------
PF11047         YAFKQLKHLACPAHQDLFTIKMDANQTQFVIDQSNIKDILNISDNC------------------------
PF00657         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxLVFFGDSLSDSLGRMFEKTHHILPSYGQYFGGRFTNGFTWTEFLSSPHFLGKEMLNFAEGGSTSAS
PF06767         ----------------------------------------------------------------------
PF11047         ----------------------------------------------------------------------
PF00657         ----IVAFGDSLTD----------------GDSNGGGWAAGLALSTCLNLPPY-GVDVINFGVGGRTSD-


                         .         .         .         +         .         .         .:280
query           YSCFNCIGDFVSNTDRQVASYTPSHQDLAIFLLGANDYMTLHKDNVIMVVEQQIDDIEKIISGGVNNVLV
PF06767         ----------------------------------------------------------------------
PF11047         ----------------------------------------------------------------------
PF00657         ------VQNLLQQLARLKEALLALSPDLVIISIGTNDLLTLKEDRG-NSVEEFIANLRKLIANGARKIVV


                         .         *         .         .         .         .         +:350
query           MGIPDLSLTPYGKHSDEKRKLKDESIAHNALLKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06767         ----------------------------------------------------------------------
PF11047         ----------------------------------------------------------------------
PF00657         MNLPPLGSSEKEDSSGCLERLNELAALYNAALR-------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06767         ----------------------------------------------------------
PF11047         ----------------------------------------------------------
PF00657         ----------------------------------------------------------