[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF68874.1

[Show Plain Result]


## Summary of Sequence Search
    1::286
   18::106     1e-20  59%  106 aa  PF02678 Pirin "Pirin"
    3::103     6e-19  49%  103 aa  PF05726 Pirin_C "Pirin C-terminal cupin domain"
   33::112     8e-04  37%  112 aa  PF10765 DUF2591 "Protein of unknown function (DUF2591)"
    1::286

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPFLLLDYAGPHTFTPGNEKRGVGEHPHRGFETVT
PF02678         ------------------------------------PFSFLDYFGPDRMGFGADRVGPGPHPHRGFETVT
PF05726         ----------------------------------------------------------------------
PF10765         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IVYSGEVEHRDSTGRGGVIGPGDVQWMTAGAGILHEEFHSDAFTRRGGELEMVQLWVxxxxxxxxxxxxx
PF02678         YVLEGEIEHRDSLGNKGRIGPGDVQWMTAGRGIVHSEMNPS----DGGPLHLLQIWL-------------
PF05726         ----------------------------------------------------------------------
PF10765         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxDNAGVVRVIAGRYEETKGPAHTFSPLNVWDMRLQRNRQLTLAQPEGWSTALVVLKG
PF02678         ----------------------------------------------------------------------
PF05726         -------------------------------------------DVTLKPGAKFTLPLPEGFNAFLYVLEG
PF10765         --------------DNGDVVAIVGN---EGGGGAGRFDPSNNWADAIERNR-IGLFEPTGWCADIANGRG


                         .         .         .         +         .         .         .:280
query           NITVNGTTPVNEAQLVVLSQQGKTLHLEASSDASVLLLSGEPLNEPIVGYGPFVMNTKQEIAEAVRDFNS
PF02678         ----------------------------------------------------------------------
PF05726         EGEVGGEETVGAGQLVVLGD-GDEVTVEAGEEARFLLLGGEPLDEPVVQYGPFVMNTQEEIEQAFEDYQA
PF10765         DIEQYGETPLRAAMRVFLASQ-------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GRFGxx
PF02678         ------
PF05726         GRFG--
PF10765         ------