[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF69275.1

[Show Plain Result]


## Summary of Sequence Search
    1::292
    3::212     2e-39  47%  213 aa  PF01557 FAA_hydrolase "Fumarylacetoacetate (FAA) hydrolase family"
    1::292

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01557         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxCVGMNYADKRIEFNETNPAPTLFVRFADSQTGHNGLLLKPENTNEFDYEGELAVVIGRRCSRVS
PF01557         ------CDGRNYAEHAKEVGRALPPPVFFLKPASSVVGPGDPIRRPRGSEKLDYEVELAVVIGKPLRGVT


                         +         .         .         .         .         *         .:210
query           AEDALDYVAGYSCYMDGSVRDWQHSWFTAGKNWPSTGSFGPCLVTTDDIPDPQMLRLLTRLNGREVQNES
PF01557         EEDALDHIFGYTLANDVSARDLQGGWFAA-KSFDGATPIGPWIVTPDALEDPRDLRLELRVNGEVVQRGN


                         .         .         .         +         .         .         .:280
query           TANMIHPIASLIAYISTFTLLSPGDTILTGSPGGVGKKRVPPLFLHDGDVIEVEIEHIGTLRNVVxxxxx
PF01557         TADMIFSPAQLIAHLSRGMTLRPGDLILTGTPSGVGGG--PRVFLKPGDVVEIEIEGLGTLRNRV-----


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxx
PF01557         ------------