[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF69484.1

[Show Plain Result]


## Summary of Sequence Search
    1::648
   16::176     5e-20  39%  177 aa  PF02687 FtsX "Predicted permease"
    1::122     2e-11  38%  123 aa  PF00005 ABC_tran "ABC transporter"
    1::648

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSTLMNILGCLDKPTSGTYRVAGR
PF02687         ----------------------------------------------------------------------
PF00005         -----------------------------------------------STLLRLLAGLLKPTSGKILLDG-


                         .         .         *         .         .         .         .:140
query           DVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIXXXXXXXXXXXXXXXXXXSDRVDY
PF02687         ----------------------------------------------------------------------
PF00005         ---VISP---LELRKLRIGYVFQDPALFPHLTVRENIAFG--LKNDEKLKEIKKKEAKEEILEALERVGL


                         +         .         .         .         .         *         .:210
query           PPSQLSGGQQQRVSIARALMNGGQVILADEPTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02687         ----------------------------------------------------------------------
PF00005         LPHELSGGQRQRVAIARALIKEPKVLLLDEPT--------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02687         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02687         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF02687         ----------------------------------------------------------------------
PF00005         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSDQAEQQLT
PF02687         -------------------------------------------------------------ADAVAKQLK
PF00005         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RLLTLRHGKKDFFTWNMDSVLKTAEKTTYTLQLFLTLVAVISLVVGGIGVMNIMLVSVTERTREIGIRMA
PF02687         KLLG--DDKVVVSTDDLDSLSQSLLQLA-SLSLILLLLAVLLLLVAALVIANTLLLSVRERRREIGILKA
PF00005         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           VGARASDVLQQFLIEAVLVCLVGGALGISLSMFIAFMLQLFLPGWEIGFSLTALASAFLCSTFTGILFGW
PF02687         LGASKRQIRRQFLLEGLLLGLLGGLLGILLGLLLSLLLSSLLLSLYLSLSLAALLLALLLALLLGLLAGL
PF00005         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LPARNAARLxxxxxxxxx
PF02687         LPARRALRL---------
PF00005         ------------------