[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF69636.1

[Show Plain Result]


## Summary of Sequence Search
    1::289
   14::279     2e-32  42%  281 aa  PF00248 Aldo_ket_red "Aldo/keto reductase family"
    1::289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxDKEECQQSVLSAIRSGYRLIDTAAVYGNEDAVGDAVRKAIATGLCTR
PF00248         -----------------------DEEEAIELLDAALEAGINFIDTAEIYGDEELLGEALKE----GGVPR


                         .         .         *         .         .         .         .:140
query           EELFITSKLWVQDMANYDLAKAGIEASLKKSGLDYFDLYLLHQAMGDYFSAWRALEDAYEAGKLKAIGVS
PF00248         EDVFIATKVWPPDLSPEHI-RASVEASLKRLGTDYIDLYLLHWPDPDIEETLEALEELVKEGKIRYIGVS


                         +         .         .         .         .         *         .:210
query           NFYAHVLANFCETVRITPMVNQVELHPYFAQPAALETMKHYNVQPEAWAPLGGGRHKPYENVMLQRIADA
PF00248         NFTAEQLEELLAHAKIPPVVVQVELLRRLEERELLPYCRENGIGVVAYSPLGGGRDKNLAAVELKEIAEK


                         .         .         .         +         .         .         .:280
query           HQKTIAQVVLRWNVQRGVTVIPKSTRQERIEENFAIWDFSLTDNEMAQINAxxxxxxxxxxxxxxxxxxx
PF00248         HGVTPAQVALAWVLSRGVTVIPGASTPEQLEENLAALDFELTDEELAEIDA-------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxx
PF00248         ---------