[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF69712.1

[Show Plain Result]


## Summary of Sequence Search
    1::3824
   14::84      2e-04  30%  291 aa  PF01297 SBP_bac_9 "Periplasmic solute binding protein family"
  463::568     8e-04  37%  675 aa  PF12245 DUF3607 "Protein of unknown function (DUF3607)"
    1::3824

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1890
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1960
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPVITSVIDDNNQPTV
PF01297         ----------------------------------------------------------------------
PF12245         -------------------------------------------------------PVVNSIQYNETSKTL


                         .         .         .         *         .         .         .:2030
query           PVLPGQSTDDRQPILNGTGEPGATITIFDNGTPLGTAQVGENGSWTFPVPRNLSEGSHNLTVSATDPAGN
PF01297         ----------------------------------------------------------------------
PF12245         TVFVNQSVWDRNVFLSDKIESGGTFTL-----STGTVTSSNTGNYTYTFDKTLPEGSYTL-VSATDEFGN


                         .         +         .         .         .         .         *:2100
query           TSAVSAPWTIVVDITPPAIPVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         TGTKTPLFTILIDNTPPVVTI-------------------------------------------------


                         .         .         .         .         +         .         .:2170
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAGNSSAVSSGFVLTIDATPPAAPVIASVADNTAPVTG
PF01297         ---------------------------------ASTSTDADDGKLKVVTTTPPLADLVKNIAGDRAEVTS
PF12245         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:2240
query           IVPNGGSTNETRPTLSGTGEAGTTISIYNGSALxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         LVPPGADPHSYEPTPRDVRKAYADLVFYNGLGL-------------------------------------
PF12245         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:2310
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:2380
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:2450
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:2520
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:2590
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:2660
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:2730
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:2800
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:2870
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:2940
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:3010
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:3080
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:3150
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:3220
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:3290
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:3360
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:3430
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:3500
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:3570
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:3640
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:3710
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:3780
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         ----------------------------------------------------------------------
PF12245         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:3850
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF01297         --------------------------------------------
PF12245         --------------------------------------------