[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF69765.1

[Show Plain Result]


## Summary of Sequence Search
    1::115
    1::116     5e-36  72%  116 aa  PF07037 DUF1323 "Putative transcription regulator (DUF1323)"
    1::115

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTPEELANLTGYSRQTINKWVRKEGWATSPKPGVQGGKARLVHVNEQVREYIRSAERSVDHHADTFTPAS
PF07037         MTPEELAELTGYARQTINKWVRKEGWKTEPKPGVKGGKARLIHVDEQVREFIRNAPRAEEPQAE-YALAG


                         .         .         *         .         .         .         .:140
query           NASLEALLMTLAKEMTSSEQKQFTSLLVREGITGLLQRLGIRDSx
PF07037         DAPLERQLITAAKEMTPSEQEQLASLLLREGIRGLLQRLGIRDS-