[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF69854.1

[Show Plain Result]


## Summary of Sequence Search
    1::71
    1::65      4e-27  88%   70 aa  PF10953 DUF2754 "Protein of unknown function (DUF2754)"
    1::71

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRLPVKIRRDWHYYAFSIGLIFILNGVVGLLGFEAKGWQTYGVGLVTWIISFWLAGFIIRRREDDxxxxx
PF10953         MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIRRRDEE-----


                         .         .         *         .         .         .         .:140
query           x
PF10953         -