[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF69930.1

[Show Plain Result]


## Summary of Sequence Search
    1::152
    4::116     8e-23  50%  119 aa  PF01797 Transposase_17 "Transposase IS200 like"
    1::152

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxYHIVFAPKYRRQAFYGEKRRAVGSILRKLCEWKNVRILEAECCADHIHMLLEIPP
PF01797         ---------------YHIVFRTKYRRKVFTDDDRERLLEILRELCEKKGFEILAYVIMPDHVHLLVEIPP


                         .         .         *         .         .         .         .:140
query           KMSVSSFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYVDTVGKNTAKIQDYIxxxxxxxxxxxxxx
PF01797         KDSLSKIMRYLKGRSSRRINKEFPELKRKYLGGHFWQRGYYEHTIGEDLERIRDYI--------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxx
PF01797         ------------