[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF70211.1

[Show Plain Result]


## Summary of Sequence Search
    1::396
   10::220     2e-07  27%  259 aa  PF00529 HlyD "HlyD family secretion protein"
    1::396

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00529         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xGILAQLTVREGDRVQANQIVARLDPTRLASNVGEXXXXXXXXXXXXXXXXXEVNDLPLAFPAELNGWPD
PF00529         -GRVTEILVKEGDRVKKGQVLARLDPTDYQAALAQAEAQLAAAQAQARLAAAQLRAQALVAQAAAASQQA


                         +         .         .         .         .         *         .:210
query           LIAAETRLYKSRRAQLADTEAELRDALASVNKELAITQRLEKSGAASHVEVLRLQRQKSDLGLKITDLRS
PF00529         LDAAQAALQQALAAVQAAAQAQLDQARANLEYAQATAPAAGRIGAA-----------QATLGALVSALQA


                         .         .         .         +         .         .         .:280
query           QYYVQAREALSKANAEVDMLSAILKGREDSVTRLTVRSPVRGIVKNIQVTTIGGVIPPNGEMMEIVPVDD
PF00529         QVLA--------AQAQLDQ-------AEVDLAQTEIRAPADGIVTNRSV-QVGQYVGAGQPLLGLVDLSD


                         .         *         .         .         .         .         +:350
query           RLLIETRLSPRDIAFIHPGQRALVKITAYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00529         -LWVDANVGETQLRAVRPGQPAPVRPDAY-----------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00529         ----------------------------------------------