[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF70405.1

[Show Plain Result]


## Summary of Sequence Search
    1::478
   10::151     3e-61  75%  151 aa  PF01050 MannoseP_isomer "Mannose-6-phosphate isomerase"
    3::232     6e-16  37%  238 aa  PF00483 NTP_transferase "Nucleotidyl transferase"
    3::67      1e-04  36%   70 aa  PF07883 Cupin_2 "Cupin domain"
    1::478

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVICNEQHRFIVAE
PF01050         ----------------------------------------------------------------------
PF00483         --------VILAGGLGTRLRPLTRER-PKKLLPVGGK-PLIQYTLERLAAAGIEEIIVVVTGYHKESIEE
PF07883         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QLRQLNKLTENIILEPAGRNTXXXXXXXXXXXTRQHTDCDPLMLVLAADHAIANEEAFRDAVRGAMPYAD
PF01050         ----------------------------------------------------------------------
PF00483         HLGDGYELGVEIVLQPEPLGTAHAVLLAADFIGDEPF----VVLVLPGDHLIDDDFA---ELLEAHRETG
PF07883         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AGKLVTFGIVPDLPETGYGYIRRGDVVPGATDAVAFEVAQFVEKPGLETAQAYVASGDYYWNSGMFLFRA
PF01050         ----------------------------------------------------------------------
PF00483         ADGLVTVGIVPVEDPTGYGVIERDE---------DGRVTRFVEKPDAETASNLANTGIYVFNPGIFDF--
PF07883         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GRYLEELKKFRPDILAACEQAMRGVDPDLDFIRVDEEAFLACPEESIDYAVMERTADAVVMPMDAGWSDV
PF01050         ----------------------------------------------------------------------
PF00483         -------------LLELLEPLARG-EPEL------TDAIPALLEEG-----------KVVVAYLFRGSDV
PF07883         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GSWSSLWxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQTKDAVLIADRHAVQDVKK
PF01050         ---------------------------------------------------ETPDAVLVADKDRVQDVKK
PF00483         GTWDSLW---------------------------------------------------------------
PF07883         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VVEKIKADGRHEHHMHREVYRPWGKYDSIDAGERYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTARVT
PF01050         IVEQLKARGREEAKEHREVYRPWGSYDVLDEGERYQVKRITVKPGARLSLQMHHHRAEHWIVVSGTAKVT
PF00483         ----------------------------------------------------------------------
PF07883         ---------------------------------------VTLPPGA--SSPWHRHPGEEFLVLEGELELT


                         .         .         +         .         .         .         .:490
query           INGEVKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFEDxxxxx
PF01050         IGDEEFLLTENESTYIPLGAKHRLENPGKIPLELIEVQSGSYLGEDDIVRFED-----
PF00483         ----------------------------------------------------------
PF07883         VDGERVELKPGDSVYIPAGTPHRVRNEGDEPAVLL-----------------------