[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for sent8:ACF70471.1

[Show Plain Result]


## Summary of Sequence Search
    1::94
    1::88      1e-21  55%   88 aa  PF01386 Ribosomal_L25p "Ribosomal L25p family"
    1::94

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxINAEVRKEQGKGASRRLRAANKFPAIIYGGSEAPIAIELDHDQVMNMQAKAEFYSEVLTLVVDGKEV
PF01386         ---LNAEVRTEQGKGAARRLRRAGKVPAVIYGGGKEPVSISVDHKELEKLLRKEAFESTVLDLEVDGKKV


                         .         .         *         .         .         .         .:140
query           KVKAQAVQRHAYKPKLTHIDFxxx
PF01386         RVLVKDVQRHPVKDKILHVDF---