[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF65854.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dhwA1.bssp"
#ERROR : Can't open dsspfile "2onkC1.bssp"
#ERROR : Can't open dsspfile "2r6gG1.bssp"
#ERROR : Can't open dsspfile "1tluA.bssp"

## Summary of PDB Search
:364
    6e-11  16%  3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN
    4e-09  15%  2onkC1 [f.58.1.1] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE C:1
    4e-08  12%  2r6gG1 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
    4e-05   5%  1tluA  [d.156.1.2] S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME,
:364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dhwA1          ----------------------------------------------------------------------
2onkC1          ----------------------------------------------------------------------
2r6gG1          ----------------------------------------------------------------------
1tluA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFRSASVLTLIKDSLPVSITLG
3dhwA1          -------------------------------------------------------MWLLVRGVWETLAMT
2onkC1          -------------------------------------------------FLKAASDPAVWKVVLTTYYAA
2r6gG1          ----------------------------------------------------------------------
1tluA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LWSTLIIYLVSIPLGIRKAVHNGSRFDVWSSAFIIIGYXXXXXXXXXXXXXXXXGGSYYDIFPLRGLVSA
3dhwA1          FVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSA-------------------IVNIFRSIPFIIL
2onkC1          LISTLIAVIFGTPLAYILARKSFPGKSVVEGIVDLPV------------------VIPHTVAGIALLVVF
2r6gG1          ----------------------------------------------------------------------
1tluA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NFDTLPWYQKITDYLWHITLPVLATVIGGFAALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFR
3dhwA1          LVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENA-LLEIPTGLIEASRAMGATPMQIVRKVLLP
2onkC1          GSSGLIGSFSPLKFVDALPGIVVAMLFVSVPIYINQAKE-GFASVDVRLEHVARTLGSSPLRVFFTVSLP
2r6gG1          ------------FIGLNTHGGVIFAYLGGIALHVWTIKGYFE-TIDSSLEEAAALDGATPWQAFRLVLLP
1tluA           ---------------------LGRHLVAEFYECDREVLDNVQ-LIEQEMKQAAYESGATIVTSTFHRFLP


                         .         *         .         .         .         .         +:350
query           NAMLLVIAGFPATFISMFFTGSLLIEVMFSLNGLGLLGYEATVSRDYPVMFGTLYIFTLIGLLLNILSDI
3dhwA1          EALPGLVNAATITLITL--VGYSAMGGAVGAGGLGQIGYQGYIGYNATVMNTVLVLLVILVYLIQFAGD-
2onkC1          LSVRHIVAGAIMSWARGISEFGAVVVIAYYPMIAPTLIYERYLSEGLSAAMPVAAILILLSL--------
2r6gG1          LSVPILAVVFILSFIAA-ITEVPVASLLLRNSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLL
1tluA           YGVSGVVVISESHLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRY------


                         .         .         .         .         *         .         .:420
query           SYTLVDPRIDFEGx
3dhwA1          --------------
2onkC1          --------------
2r6gG1          AQRWLVNGLTAGG-
1tluA           --------------