[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF65890.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gg1A.bssp"
#ERROR : Can't open dsspfile "1d9eA.bssp"
#ERROR : Can't open dsspfile "1iyjB3.bssp"
#ERROR : Can't open dsspfile "1rzmA.bssp"
#ERROR : Can't open dsspfile "1iw2A.bssp"

## Summary of PDB Search
:350
    e-162  92%  1gg1A  [c.1.10.4] 3-DEOXY-D-ARABINO-HEPTULOSONATE-7-PHOSPHATE
    5e-49  16%  1d9eA  [c.1.10.4] 3-DEOXY-D-MANNO-OCTULOSONATE 8-PHOSPHATE
    1e-43  20%  1iyjB3 [b.40.4.3] BREAST CANCER SUSCEPTIBILITY B:2599 -- 2731
    1e-41  22%  1rzmA  [c.1.10.4] PHOSPHO-2-DEHYDRO-3-DEOXYHEPTONATE ALDOLASE
    9e-04  19%  1iw2A  [b.60.1.1] COMPLEMENT PROTEIN C8GAMMA
:350

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxDLRIKEINELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHDPXXXX
1gg1A           ------DLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHDPVAAK
1d9eA           ---------------------------------------VVSIGDINVANDLPFVLFGGMNVLESRDLAM
1iyjB3          ---------------------------------------RSALKKILERDDTAKTLVLCVSDIISLSKVD
1rzmA           -------------DDRYVVADKFESLDCVESVVRVLFHPEDTVIDLVKIGNGYFTIIAGPCSVEGREMLM
1iw2A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXRDELQGELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPA
1gg1A           EYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPA
1d9eA           RICEHYVTVTQKLG--IPYVFKASFDKARSSISYRGPG----------LEEGMKIFQELK---QTFGVKI
1iyjB3          TIELTDGWYA--VKAQLDPPLLALVKSGRLTVGQKIITQGAELVGSPDACAPLEAPDSLRLKISANSTRP
1rzmA           ETAHFLSELGVKV-------LRGGAYKPRTPYSFQGLGEK-----------GLEYLREAADKY---GMYV
1iw2A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFL
1gg1A           AGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFL
1d9eA           ITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSPGQMGNIV----------
1iyjB3          ARSKLGFHDPRPF---------------------------------------------------------
1rzmA           VTEALGEDDLPKVAEYADIIQIGARNAQNFRLLSKAGSYNKPVLLKRGFMNTIE---EFLLSA-------
1iw2A           ------------------------------------------LYGDTGVLGRFLL--QARGARGAVHVVV


                         .         .         .         +         .         .         .:280
query           SVTKWGHSAIVNTSGNGDCHIILRGGKAPNYSAQHVAEVKEGLIKAGLTPQVMIDFSHANSCKQFQKQME
1gg1A           SVTKWGHSAIVNTSGNGDCHIILRGGKEPNYSAKHVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMD
1d9eA           --------DKFKEGGNEKVILCDRGANFGYDNLVVDMLGFSIMKKVSGNSPVIFDVTHALQRAQ------
1iyjB3          ----------------------------------------------------------------------
1rzmA           --------EYIANSGNTKIILCERGIRTFEKATRNTLDISAPIIRKESHLPILVDPSHSGGRRDLVIPLS
1iw2A           AETDYQSFAVLYLERAGQLSVKLYARS-LPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEA------


                         .         *         .         .         .         .         +:350
query           VCADVCQQIAGGEKAIIGVMVESHLVEGNQSLESGQPLTYGKSITDACIGWEDTDALLRQLSAAVKARRx
1gg1A           VCADVCQQIAGGEKAIIGVMVESHLVEGNQSL----PLAYGKSITDACIGWEDTDALLRQLANAVKARR-
1d9eA           VAELARAGMAVG---LAGLFIEAHPDPEPSALPLAK--------------LEPFLKQMKAIDDLVKGFE-
1iyjB3          ----------------------------------------------------------------------
1rzmA           RAA-----IAVGAH---GIIVEVHLSDGKQSLD-------------------------------------
1iw2A           ----------------------------------------------------------------------