[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF65947.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b13A.bssp"
#ERROR : Can't open dsspfile "1vhnA.bssp"

## Summary of PDB Search
:353
    4e-13  37%  1b13A  [g.41.5.1] PROTEIN (RUBREDOXIN)
    6e-05  19%  1vhnA  [c.1.4.1] PUTATIVE FLAVIN OXIDOREDUCATASE
:353

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b13A           ----------------------------------------------------------------------
1vhnA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b13A           ----------------------------------------------------------------------
1vhnA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxAGLMNGAFIAHEIAERVKQPVKEPHIINLTLLPVNDADREYLDHFL
1b13A           ----------------------------------------------------------------------
1vhnA           ------------------------GALLKDLRHFRYIVRELRKSVSGKFSVKTRLGWEKNEVEEIYRILV


                         .         .         .         +         .         .         .:280
query           GEGCSAIFSRGYGKCRIVSTHFPGVWRVNYFNDMNTLLQDMIEIADIPDIAVAGIDDIEDAYAGLKNTxx
1b13A           ----------------------------------------------------------------------
1vhnA           EEGVDEVFIH----TRTVVQSFTGRAEWKALSVLEK---------RIPTFVSGDIFTPEDAKRALEES--


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxMECKVCWWVYDPALGDDVWQIPPGVPFSQLPDYWCCPVCETSKSGFMVIDExxxx
1b13A           ---------------YTCTVCAYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE----
1vhnA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxx
1b13A           ---
1vhnA           ---