[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF66015.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1qsaA2.bssp"
#ERROR : Can't open dsspfile "1xsfA1.bssp"
#ERROR : Can't open dsspfile "153lA.bssp"
#ERROR : Can't open dsspfile "132lA.bssp"
#ERROR : Can't open dsspfile "2rh3A1.bssp"

## Summary of PDB Search
:160
    8e-17  26%  1qsaA2 [d.2.1.6] PROTEIN (SOLUBLE LYTIC TRANSGLYCOSYLASE SLT70)
    5e-15  13%  1xsfA1 [d.2.1.8] PROBABLE RESUSCITATION-PROMOTING FACTOR RPFB A:23
    8e-14  18%  153lA  [d.2.1.5] GOOSE LYSOZYME
    5e-06  38%  132lA  [d.2.1.2] HEN EGG WHITE LYSOZYME
    9e-06   7%  2rh3A1 [a.43.1.10] PROTEIN VIRC2 A:82 -- 202
:160

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFH
1qsaA2          ----------------AYNDLFKRYTSGKEIPQSYAMAIARQESAWNPKVKS----PVGASGLMQIMPGT
1xsfA1          ------------------------------IDGSIWDAIAGCEAGGNWAINT----GNGYYGGVQFDQGT
153lA           ----------------RYKTIIKKVGEKLCVEPAVIAGIISRESHAGKVLKNGWGDRGNGFGLMQVDKRS
132lA           --------------------------------------AAXFESNFNTQATNRNTDGSTDYGILQINSRW
2rh3A1          ----------------IPHTAFEKSIIVQTSRMFPVSLIEAARNHFDPLGLE----TARAFGHKLA----


                         .         .         *         .         .         .         .:140
query           MKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYR
1qsaA2          ATHTVKMGYSSPGQLLDPETNINIGTSYLQYVYQQFGNNRISSAAYNAGPGRVRTWLGNSAGRIDAVAFV
1xsfA1          WEANGGLRYAPRADLATREEQIAVAEVTRLRQGWGAWPVC--AARAGA----------------------
153lA           HKPQGT-----WNGEVHITQGTTILINFIKTIQKKFPSLKGGISAYNAGAGNVRSYARMDYANDVVARAQ
132lA           WCNDGRTPGS-RNLCNIPC---------------------------------------------------
2rh3A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KLKGMSAEEKNxxxxxxxxx
1qsaA2          ESI-PFSETRG---------
1xsfA1          --------------------
153lA           YYK-----------------
132lA           --------------------
2rh3A1          --------------------