[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF66076.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1kqfB1.bssp"
#ERROR : Can't open dsspfile "1h0hB.bssp"
#ERROR : Can't open dsspfile "1ti2B2.bssp"
#ERROR : Can't open dsspfile "1a6lA.bssp"
#ERROR : Can't open dsspfile "1gt8A1.bssp"
#ERROR : Can't open dsspfile "1kqfB2.bssp"
#ERROR : Can't open dsspfile "1gt8A5.bssp"
#ERROR : Can't open dsspfile "1hfeL2.bssp"
#ERROR : Can't open dsspfile "1jnrB.bssp"
#ERROR : Can't open dsspfile "1h98A.bssp"
#ERROR : Can't open dsspfile "2v4jB1.bssp"
#ERROR : Can't open dsspfile "1bluA.bssp"
#ERROR : Can't open dsspfile "2akjA3.bssp"
#ERROR : Can't open dsspfile "2fug91.bssp"
#ERROR : Can't open dsspfile "2fug34.bssp"
#ERROR : Can't open dsspfile "1c4aA3.bssp"
#ERROR : Can't open dsspfile "1b0pA5.bssp"
#ERROR : Can't open dsspfile "1jb0C.bssp"
#ERROR : Can't open dsspfile "2gmhA3.bssp"
#ERROR : Can't open dsspfile "1nekB1.bssp"
#ERROR : Can't open dsspfile "2v4jA1.bssp"
#ERROR : Can't open dsspfile "1xerA.bssp"
#ERROR : Can't open dsspfile "1d0cA.bssp"
#ERROR : Can't open dsspfile "1kf6B1.bssp"
#ERROR : Can't open dsspfile "1durA.bssp"
#ERROR : Can't open dsspfile "1iqzA.bssp"
#ERROR : Can't open dsspfile "1fxdA.bssp"

## Summary of PDB Search
:294
    2e-98  93%  1kqfB1 [d.58.1.5] FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, IRON-
    2e-59  34%  1h0hB  [d.58.1.5] FORMATE DEHYDROGENASE (SMALL SUBUNIT)
    3e-45  26%  1ti2B2 [d.58.1.5] PYROGALLOL HYDROXYTRANSFERASE SMALL SUBUNIT B:1
    2e-15  17%  1a6lA  [d.58.1.2] FERREDOXIN
    2e-14   9%  1gt8A1 [a.1.2.2] DIHYDROPYRIMIDINE DEHYDROGENASE A:2 -- 183
    2e-14  92%  1kqfB2 [f.23.22.1] FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, IRON-
    1e-11  15%  1gt8A5 [d.58.1.5] DIHYDROPYRIMIDINE DEHYDROGENASE A:845 -- 1020
    3e-11  19%  1hfeL2 [d.58.1.5] PROTEIN (FE-ONLY HYDROGENASE (E.C.1.18.99.1) L:2
    4e-11  18%  1jnrB  [d.58.1.5] ADENYLYLSULFATE REDUCTASE
    9e-11  24%  1h98A  [d.58.1.2] FERREDOXIN
    1e-10  19%  2v4jB1 [d.58.1.5] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    3e-10  25%  1bluA  [d.58.1.1] FERREDOXIN
    3e-10  10%  2akjA3 [d.134.1.1] FERREDOXIN--NITRITE REDUCTASE, CHLOROPLAST A:431
    6e-10  35%  2fug91 [d.58.1.5] NADH-QUINONE OXIDOREDUCTASE CHAIN 9 9:26 -- 179
    1e-09  13%  2fug34 [d.58.1.5] NADH-QUINONE OXIDOREDUCTASE CHAIN 3 3:96 -- 246
    1e-08  17%  1c4aA3 [d.58.1.5] PROTEIN (FE-ONLY HYDROGENASE) A:127 -- 209
    1e-08  17%  1b0pA5 [d.58.1.5] PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
    7e-08  19%  1jb0C  [d.58.1.2] PHOTOSYSTEM I IRON-SULFUR CENTER
    6e-07  12%  2gmhA3 [d.58.1.6] ELECTRON TRANSFER FLAVOPROTEIN-UBIQUINONE A:483
    7e-07  15%  1nekB1 [a.1.2.1] SUCCINATE DEHYDROGENASE IRON-SULFUR PROTEIN B:107
    8e-07  15%  2v4jA1 [d.58.1.5] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    1e-06  22%  1xerA  [d.58.1.3] FERREDOXIN
    6e-06  13%  1d0cA  [d.174.1.1] BOVINE ENDOTHELIAL NITRIC OXIDE SYNTHASE HEME
    1e-05  13%  1kf6B1 [a.1.2.1] FUMARATE REDUCTASE IRON-SULFUR PROTEIN B:106 --
    1e-05  35%  1durA  [d.58.1.1] 2[4FE-4S] FERREDOXIN
    3e-05  16%  1iqzA  [d.58.1.4] FERREDOXIN
    5e-05  24%  1fxdA  [d.58.1.4] FERREDOXIN II
:294

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSMETQDIIKRSATNAITPPPQARDYKAEVAKLIDVSSCVGCKACQVACSEWNDIRDNVGHCVGVYDNPA
1kqfB1          -AMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPA
1h0hB           --------------------------------FVDTTRCTACRGCQVACKQWHGNPATPTENTGFHQNPP
1ti2B2          --------------------------------VIDVAKCQDCNNCFMGCMDEHELNEWPGYTASMQRGH-
1a6lA           ----------------------------------------------------------------------
1gt8A1          ------------DVADIESILALNPRTQSHAALHSTLAKKLDKKHWKRNPDKNCFHCEKLENNFDDIKHT
1kqfB2          ----------------------------------------------------------------------
1gt8A5          ----------------------------------------------------------------------
1hfeL2          ----------------------------------------------------------------------
1jnrB           ----------------------------------------------------------------------
1h98A           ----------------------------------------------------------------------
2v4jB1          ----------------------------------------------------------------------
1bluA           ----------------------------------------------------------------------
2akjA3          --------------------------------MKGLVACTGSQFCGQAIIETKARAL-------------
2fug91          ----------------------------------------------------------------------
2fug34          --------------------DVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRT-------------
1c4aA3          ----------------------------------------------------------------------
1b0pA5          ---------------------------------WVPENCIQCNQCAFVCPHSAILPVLAKEEELVGAPAN
1jb0C           ----------------------------------------------------------------------
2gmhA3          ----------------------------------------------------------------------
1nekB1          ----------------------------------------------------------------------
2v4jA1          ----------------------------------------------------------------------
1xerA           ----------------------------------------------------------------------
1d0cA           -----------------------LQEVEAEVASTGTYHLRESELVFGAKQAWRNAPRCVGR---------
1kf6B1          ----------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
1iqzA           ----------------------------------------------------------------------
1fxdA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DLSAKSWTVMRFTETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSEHCIGCGYCI
1kqfB1          DLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCI
1h0hB           DFNFHTYKLVRMHEQEIDGRIDWLFFPDQCRHCIAPPCKATADESAIIHDDATGCVLFKTKDLEDYESVI
1ti2B2          -----RWMNIERRERGTYPRNDINYRPTPCMHCENAPCVAKGN--GAVYQREDGIVLIDPEKAKGKKELL
1a6lA           ------------------------VVTDNCIKCKYCDCVEVCP-VDCFYEGPNFLVIHP-DECIDCALCE
1gt8A1          TLGERGALRERCLKCADAPCQKSCPTHLDIKSFITSISNKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCV
1kqfB2          ----------------------------------------------------------------------
1gt8A5          -------------------------------------LQYLGT-FGELSNIEQVVAVIDEEMCINCGKCY
1hfeL2          ---------------------------------ERIEYEMHTP-DPKADPDKLHFVQIDEAKCIGCDTCS
1jnrB           ----------------------------GCKALERTACEYICPNDLMTLDKEKMAYNREPDMCWECYSCV
1h98A           ------------------------VICEPCIGVKDQSCVEVCPVE--CIYDGGDQFYIHPEECIDCGACV
2v4jB1          -----------------------------------------------------MIDHEWTDQLCEIPLAV
1bluA           ------------------------------------------------------------DECINCDVCE
2akjA3          ------KVTEEVQRLVSVTRPVRMHWTGCPNSCGQVQVADIGFMG-CMTRDENGKPCEGADVFVGGRIGS
2fug91          ------------------------------------------------------------EKCIGCSLCA
2fug34          ------------------------VEYGLYEKLPVYTRFEFTRRHVDKHHPLSPFVILDRERCIHCKRCV
1c4aA3          ------------------------------------------------VDERSKSLTVDRTKCLLCGRCV
1b0pA5          F-----TALEAKGKELKGYKFRIQINTLDCMGCGN--CADICPPK--EKALVMQPLDTQRDAQVPNLEYA
1jb0C           ------------------------------------------------------------DTCIGCTQCV
2gmhA3          ------------------------------------------------LTLKDDSVPVNRNLSIYDGPEQ
1nekB1          -----------------------------------LNNGQNPPAREHLQMPEQREKLDGLYECILCACCS
2v4jA1          DIKIDAEAVKAYVAGEFKPNAGAHSGRDWGKFDIEAEVVNRCPSKC--MKWDGSKLSIDNKECVRCMHCI
1xerA           -----------------------------GEHSGHKVYGPVEPPX--VLGIHGTIVGVDFDLCIADGSCI
1d0cA           ---IQWGKLQVFDARDCSSAQE--MFTYICNHIKYATNRGNLRSAITVFPQRAGRGDFRIWNSQLVRYAG
1kf6B1          -----------------------------AITLAHRYNEDSRDH-GKKERMAQLNSQNGVWSCTFVGYCS
1durA           ---------------------------DSCIACGA--CKPECP-VNCIQE--GSIYAIDADSCIDCGSCA
1iqzA           -------------------------------------DEDGIAYV--TLDDNQGIVEVPDILIDDMMDAF
1fxdA           ------------------------------------------------------------DDCMAXEACV


                         +         .         .         .         .         *         .:210
query           AGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELGEQRVEKLKARGFEH
1kqfB1          AGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEH
1h0hB           SACPYDVPRKVAESNQMAKCDMCIDRITNGLRPACVTSCPTGAMNFGDLSEMEAMASARLAEIKA-AYSD
1ti2B2          DTCPYGVMYWNEEENVAQKCTMCAHLSWAPKMPRCAHNCGSFVYEF------------------------
1a6lA           PECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQH-------------
1gt8A1          GGCNLYATEEGSINIGGLQQFASEVFKAMNIPQIRNPCLPSQEK--------------------------
1kqfB2          ----------------------------------------------------------------------
1gt8A5          MTCNDSGYQAIQFD---PETHLPTVTDTCTGCTLCLSVCPIIDCIRMVSRTTPYEPKRGL----------
1hfeL2          QYCPTAAIFGEMGEPHSIPHIEACINC-----GQCLTHCPENAIYEA-----------------------
1jnrB           KMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRN------------------------------
1h98A           PACPVNAIYPEEDVPEQWKSYIEKNRKLAG----------------------------------------
2v4jB1          ASCPTAAVRPTKLIGDKKVNTIAIKNERCMYCGNCYTMCPALPISDG-----------------------
1bluA           PECPNGAISQG-DETYVIEPSLCTECVGHYETSQCVEVCPVDCIIKDPSHEETE--DELRAKYE------
2akjA3          DSHLGDIYK--KAVPCKDLVPVVAEIL-------------------------------------------
2fug91          AACPAYAIYVEPAENDPENPVSAGERYAKVYEGLCEEACPTGAIVLGYDFEM------------------
2fug34          RYFEEVPGDEVLERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTARF-------------------
1c4aA3          NACGKNTETYAMKFLNKNGKTIIFDDTNCLLCGQCIIACPVAALSEKS----------------------
1b0pA5          ARIP------------------------------------------------------------------
1jb0C           RACPTDVLEMVPWDGKAGQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGA------------------
2gmhA3          RFCPAGVYE-FVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGG------------------
1nekB1          TSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTMNCVSVCPKGLNPTRAIGHI------------------
2v4jA1          NTMPRALHIGDE----------------------------------------------------------
1xerA           NACPVNVFQWYDTPGHPASEKKADPVNACIFCMACVNVCPVAAIDVKP----------------------
1d0cA           YRQQDGSVR-------------------------------------------------------------
1kf6B1          EVCPKHVDPAAAIQQGKVESS-------------------------------------------------
1durA           SVCPVGAP--------------------------------------------------------------
1iqzA           EGCPTDSIKVADEP--------------------------------------------------------
1fxdA           EICPDVFEMNEEGDKVVINPDSDLDCV-----EEAIDSCPAEAIV-------------------------


                         .         .         .         +         .         .         .:280
query           AGIYNPQGVGGTHVMYVLHHANQPELYHGLPKDPQIDTSINLWKGALKPLAAAGFIATFAGLIYHYIGIG
1kqfB1          AGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPK-----------------------------------
1h0hB           AKLCDPDDV---RVIFLTAH--NPKLYH------------------------------------------
1ti2B2          ----------------------------------------------------------------------
1a6lA           ----------------------------------------------------------------------
1gt8A1          ----------------------------------------------------------------------
1kqfB2          -----------------------------------IDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIG
1gt8A5          ----------------------------------------------------------------------
1hfeL2          ----------------------------------------------------------------------
1jnrB           ----------------------------------------------------------------------
1h98A           ----------------------------------------------------------------------
2v4jB1          ----------------------------------------------------------------------
1bluA           ----------------------------------------------------------------------
2akjA3          ----------------------------------------------------------------------
2fug91          ----------------------------------------------------------------------
2fug34          ----------------------------------------------------------------------
1c4aA3          ----------------------------------------------------------------------
1b0pA5          ----------------------------------------------------------------------
1jb0C           ----------------------------------------------------------------------
2gmhA3          ----------------------------------------------------------------------
1nekB1          ----------------------------------------------------------------------
2v4jA1          ----------------------------------------------------------------------
1xerA           ----------------------------------------------------------------------
1d0cA           ----------------------------------------------------------------------
1kf6B1          ----------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
1iqzA           ----------------------------------------------------------------------
1fxdA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PNKxxxxxxxxxxx
1kqfB1          --------------
1h0hB           --------------
1ti2B2          --------------
1a6lA           --------------
1gt8A1          --------------
1kqfB2          PNK-----------
1gt8A5          --------------
1hfeL2          --------------
1jnrB           --------------
1h98A           --------------
2v4jB1          --------------
1bluA           --------------
2akjA3          --------------
2fug91          --------------
2fug34          --------------
1c4aA3          --------------
1b0pA5          --------------
1jb0C           --------------
2gmhA3          --------------
1nekB1          --------------
2v4jA1          --------------
1xerA           --------------
1d0cA           --------------
1kf6B1          --------------
1durA           --------------
1iqzA           --------------
1fxdA           --------------