[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF66209.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2g0uA1.bssp"

## Summary of PDB Search
:71
    3e-13  23%  2g0uA1 [a.2.20.1] TYPE III SECRETION SYSTEM NEEDLE PROTEIN A:1 --
:71

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDIAQLVDMLSHMAHQAGQAINDKMNGNDLLNPESMIKAQFALQQYSTFINYESSLIKMIKDMLSGIxxx
2g0uA1          TGIGRAFDDGVKDLNKQLQDAQANLTKN-PSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSI---


                         .         .         *         .         .         .         .:140
query           x
2g0uA1          -