[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF66348.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bxzA1.bssp"
#ERROR : Can't open dsspfile "1kolA1.bssp"
#ERROR : Can't open dsspfile "1uufA1.bssp"
#ERROR : Can't open dsspfile "1a71A1.bssp"
#ERROR : Can't open dsspfile "1f8fA1.bssp"
#ERROR : Can't open dsspfile "1gv8A.bssp"
#ERROR : Can't open dsspfile "1e3jA1.bssp"
#ERROR : Can't open dsspfile "1vj0A1.bssp"
#ERROR : Can't open dsspfile "1gu7A1.bssp"
#ERROR : Can't open dsspfile "1v3tA1.bssp"
#ERROR : Can't open dsspfile "1qorA1.bssp"
#ERROR : Can't open dsspfile "1o89A1.bssp"
#ERROR : Can't open dsspfile "1e0tA3.bssp"
#ERROR : Can't open dsspfile "1escA.bssp"
#ERROR : Can't open dsspfile "1ynsA1.bssp"
#ERROR : Can't open dsspfile "1h2bA2.bssp"
#ERROR : Can't open dsspfile "1pqwA.bssp"
#ERROR : Can't open dsspfile "1bxzA2.bssp"
#ERROR : Can't open dsspfile "1e3jA2.bssp"
#ERROR : Can't open dsspfile "1vj0A2.bssp"
#ERROR : Can't open dsspfile "1ztpA1.bssp"
#ERROR : Can't open dsspfile "1iyzA1.bssp"
#ERROR : Can't open dsspfile "1lluA2.bssp"
#ERROR : Can't open dsspfile "1vj1A1.bssp"
#ERROR : Can't open dsspfile "2ck3H2.bssp"
#ERROR : Can't open dsspfile "1v3tA2.bssp"
#ERROR : Can't open dsspfile "1kolA2.bssp"
#ERROR : Can't open dsspfile "1o54A.bssp"
#ERROR : Can't open dsspfile "1yb5A2.bssp"
#ERROR : Can't open dsspfile "1a71A2.bssp"
#ERROR : Can't open dsspfile "1txqA1.bssp"
#ERROR : Can't open dsspfile "1iyzA2.bssp"
#ERROR : Can't open dsspfile "1a9xA3.bssp"
#ERROR : Can't open dsspfile "1o89A2.bssp"
#ERROR : Can't open dsspfile "1ixkA.bssp"
#ERROR : Can't open dsspfile "1omoA.bssp"
#ERROR : Can't open dsspfile "1piwA2.bssp"
#ERROR : Can't open dsspfile "1b6rA2.bssp"

## Summary of PDB Search
:339
    5e-36  18%  1bxzA1 [b.35.1.2] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:1 -- 139
    9e-32  22%  1kolA1 [b.35.1.2] FORMALDEHYDE DEHYDROGENASE A:2 -- 160 A:356 --
    9e-32  31%  1uufA1 [b.35.1.2] ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN A:3
    4e-30  22%  1a71A1 [b.35.1.2] LIVER ALCOHOL DEHYDROGENASE A:1 -- 163 A:340 --
    4e-29  25%  1f8fA1 [b.35.1.2] BENZYL ALCOHOL DEHYDROGENASE A:4 -- 162 A:337 --
    6e-28   8%  1gv8A  [c.94.1.2] OVOTRANSFERRIN
    7e-26  30%  1e3jA1 [b.35.1.2] NADP(H)-DEPENDENT KETOSE REDUCTASE A:4 -- 142
    2e-22  25%  1vj0A1 [b.35.1.2] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:2 -- 155
    1e-20  16%  1gu7A1 [b.35.1.2] 2,4-DIENOYL-COA REDUCTASE A:23 -- 160 A:350 --
    2e-19  14%  1v3tA1 [b.35.1.2] LEUKOTRIENE B4 12- A:1 -- 112 A:295 -- 329
    3e-19  19%  1qorA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:2 -- 112 A:292 -- 327
    1e-18  17%  1o89A1 [b.35.1.2] YHDH A:1 -- 115 A:293 -- 323
    1e-17  13%  1e0tA3 [c.49.1.1] PYRUVATE KINASE A:354 -- 470
    1e-17  10%  1escA  [c.23.10.1] ESTERASE
    8e-15  15%  1ynsA1 [c.108.1.22] E-1 ENZYME A:4 -- 256
    2e-13  20%  1h2bA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:155 -- 326
    6e-13   8%  1pqwA  [c.2.1.1] POLYKETIDE SYNTHASE
    1e-12  19%  1bxzA2 [c.2.1.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:140 -- 313
    4e-12  23%  1e3jA2 [c.2.1.1] NADP(H)-DEPENDENT KETOSE REDUCTASE A:143 -- 312
    8e-12  21%  1vj0A2 [c.2.1.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:156 --
    1e-11   6%  1ztpA1 [d.86.1.2] BASOPHILIC LEUKEMIA EXPRESSED PROTEIN BLES03 A:17
    1e-11  25%  1iyzA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:1 -- 98 A:270 -- 302
    1e-10  21%  1lluA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:144 -- 309
    2e-10  11%  1vj1A1 [b.35.1.2] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE A:-1 --
    1e-09  17%  2ck3H2 [b.93.1.1] ATP SYNTHASE DELTA CHAIN H:17 -- 101
    2e-08  18%  1v3tA2 [c.2.1.1] LEUKOTRIENE B4 12- A:113 -- 294
    7e-08  18%  1kolA2 [c.2.1.1] FORMALDEHYDE DEHYDROGENASE A:161 -- 355
    8e-08  14%  1o54A  [c.66.1.13] SAM-DEPENDENT O-METHYLTRANSFERASE
    1e-07  18%  1yb5A2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:121 -- 294
    1e-07  12%  1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339
    2e-07  20%  1txqA1 [b.34.10.1] DYNACTIN 1 A:25 -- 98
    3e-07  16%  1iyzA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:99 -- 269
    3e-06  14%  1a9xA3 [c.30.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN) A:1
    4e-05  11%  1o89A2 [c.2.1.1] YHDH A:116 -- 292
    5e-05  20%  1ixkA  [c.66.1.38] METHYLTRANSFERASE
    2e-04   9%  1omoA  [c.2.1.13] ALANINE DEHYDROGENASE
    4e-04  16%  1piwA2 [c.2.1.1] HYPOTHETICAL ZINC-TYPE ALCOHOL DEHYDROGENASE-
    9e-04  24%  1b6rA2 [c.30.1.1] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE
:339

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKSIVIEKPNTLTIETRALPQPAPGEVRIKVKLAGICGSDSHIYRGHNPFAKYPRVIGHEFFGVIDAVGD
1bxzA1          MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGS
1kolA1          NRGVVYLGSGDYPKMQDPRGKKIEHGVILKVVSTNICGSDQHMVRGRTTA-QVGLVLGHEITGEVIEKGR
1uufA1          IKAVGAYSAKPLEPMDITRREPGPNDVKIEIAYCGVCHSDLHQVRSEWAGTVYPCVPGHEIVGRVVAVGD
1a71A1          CKAAVLWEEKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPV-IAGHEAAGIVESIGE
1f8fA1          IAAVTPCKGADFELQALKIRQPQGDEVLVKVVATGMCHTDLIVRDQKYP-VPLPAVLGHEGSGIIEAIGP
1gv8A           ------------SYYAVAVVKKGTDFMIKDLRGKTSCHTGLGRSAGWNIP-----IGTLIHRGDIEWEGI
1e3jA1          LSAVL-YKQNDLRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYEIADFIVKDPMVIGHEASGTVVKVGK
1vj0A1          AHAMVLEKFNPLVYKEFEISDIPRGSILVEILSAGVCGSDVHMFRGEDPRVPLPIILGHEGAGRVVEVNG
1gu7A1          AQAVLYTQHGFTQSFEIDDDNLAPNEVIVKTLGSPVNPSDINQIQGVYPSTEPAAPCGNEGLFEVIKVGS
1v3tA1          AKSWTLKKQSDFELKTVELPPLKNGEVLLEALFLSVDPYMRIASKRLKE---GAVMMGQQVARVV---ES
1qorA1          -TRIEFHKHGVLQAVEFTPADPAENEIQVENKAIGINFIDTYIRSGLYPPPSLPSGLGTEAAGIVSKVGS
1o89A1          LQALLLEQQTLASVQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIINFPMIPGIDFAGTV--RTS
1e0tA3          APLIVVATQGGKSA--RAVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLVKEITSTDDFYRLGKELAL
1escA           ----------------------------------------------------------------TVFFGD
1ynsA1          -------------FTAGRMKAEFFADVVPAVRKWREAGMKVYIYS-SGSVEAQKLLFGHSTEGDILELVD
1h2bA2          ----------------------------------------------------------------------
1pqwA           ----------------------------------------------------------------------
1bxzA2          ----------------------------------------------------------------------
1e3jA2          ----------------------------------------------------------------------
1vj0A2          ----------------------------------------------------------------------
1ztpA1          ----------------------------------------------------------------------
1iyzA1          MKAWVLKRLGGLELVDLPEPEAEEGEVVLRVEAVGLNFADHLMRLGAYLTRHPPFIPGMEVVGVVE----
1lluA2          ----------------------------------------------------------------------
1vj1A1          -------VAENFRVEEFSLLDANEGQVQVRTLYLSVDPYXRCKXNEDTGLAPWQLAQVADGGGIGIVEES
2ck3H2          --SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVT--------------------------
1v3tA2          ----------------------------------------------------------------------
1kolA2          ----------------------------------------------------------------------
1o54A           -------------------------------------------------------------------VGK
1yb5A2          ----------------------------------------------------------------------
1a71A2          ----------------------------------------------------------------------
1txqA1          ----------------------------------------------------------------------
1iyzA2          ----------------------------------------------------------------------
1a9xA3          ----------------------------------------------------------------------
1o89A2          ----------------------------------------------------------------------
1ixkA           ----------------------------------------------------------------------
1omoA           ----------------------------------------------------------------------
1piwA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           NVNRDRIGERVSVDPVISCGHCYPCSVGKPNVCTSLVVLGVHRDGGFSEYAVAPARNAHRIPDNIADHHA
1bxzA1          EVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLKFSNVKDGVFGEFFHVNDMNLAHLPKEVDPSKL
1kolA1          DVENLQIGDLVSVPFNVACGRCRSCKEMHTGVCLTVNPARAGGAYGEYVLVPYADFNLLKLPDRDKAMEI
1uufA1          QVEKYAPGDLVGVCIVDSCKHCEECEDGLENYCDHMTDEPGHTLGGYSQQIVVHERYVLRIRVA--DIEM
1a71A1          GVTTVRPGDKVIPLWTPQCGKCRVCKHPEGNFCLKNDLSMRGTMQDGTSRFTCRGKPIHHFLGTSTFSQY
1f8fA1          NVTELQVGDHVVL-SYGYCGKCTQCNTGNPAYCSEFFGRNFSAQSSFATYALSRENNTVKVTKDFPFDQL
1gv8A           ESGSVEQAVAKFFGATTEQKLCRQCKGDAKTKCLR-NAPYSGYSGAFQCLKDGKGDVAFVKHTTVQENAP
1e3jA1          NVKHLKKGDRVAVEPGVPCRRCQFCKEGKYNLCPDLTFCTPPDDGNLARYYVHAADFCHKLPDNCNVKQV
1vj0A1          EKRDLNGEDLIVWNRGITCGECYWCKVSKEPYLCPNRSEYPHLRGCYSSHIVLDPETDVLKVSEKITHRL
1gu7A1          NVSSLEAGDW--------------------------VIPSHVNFGTWRTHALGNDDDFIKLPNPAQSKAN
1v3tA1          KNSAFPAGSIV-LAQSGWTTHFISDGKGLEKLLEWPDKKIQYHEHVTKGFENMPAAFIEMLN--------
1qorA1          GVKHIKAGDRVVYAQSALGAYSSVHNIIADKAAIKVDVAEQQKYPLKDAQRAHEILESR-----------
1o89A1          EDPRFHAGQEVLLTGWGVGENH---------------------WGGLAEQARVKGDWLVAMPQGQAAKEI
1e0tA3          QSGLAHKGDVVVMVSGALVGTTNTASVHV-----------------------------------------
1escA           SY---TANFGIAPVTNQDSERGWCFQAKENYPAVATRSLHFWEKQELPFGAGELPPQQDALKQDTQLTVG
1ynsA1          GHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYS
1h2bA2          ------------------------------------------------------------ISREKLVEMA
1pqwA           ------------------------------------------------------------------NEAA
1bxzA2          ------------------------------------------------------------IPLEAA---V
1e3jA2          ------------------------------------------------------------------LEEG
1vj0A2          --------------------------------------------------------------DDLDVLAM
1ztpA1          ---------------------------------------PNSEPVGWIAVYGQGYSPNSGDVQGLQAAWE
1iyzA1          -------GRRY-------------AALVPQ--------------GGLAERVAVPKGALLPLPE-------
1lluA2          ---------------------------------------------------------------------A
1vj1A1          KHQKLAKGDFV-----------------------------TSFYWPWQTKAILDGNGLEKVDPQLVDGL-
2ck3H2          ----------------------------------------------------------------------
1v3tA2          ------------------------------------------------------------LPLSLAL--G
1kolA2          ---------------------------------------------------------------------T
1o54A           VADTLKPGDRVLLSFEDESEFLVDLEKDKKLHTHLGIIDLNEVFEKRTSAGKKGYILIPSLIDEIMNMKR
1yb5A2          ---------------------------------------------------------------------A
1a71A2          ---------------------------------------------------------------------C
1txqA1          -----RVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKG-------------------------
1iyzA2          ---------------------------------------------------------------------A
1a9xA3          ----------------------------------------------------------------------
1o89A2          ----------------------------------------------------------------------
1ixkA           ----------------------------------------------------------------------
1omoA           ---KVYLEFEKGDLRAMPAHLMGYAGLKWVNSHPGNPDKGLPTVMALMILNSPETGFPLAVMDA---TYT
1piwA2          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VMVEPFTIAANVTGQVNPTEQDVALIYGAGPMGLTTVQALKGVYQVKTVIVVDRIEERLAMAKQSGADWT
1bxzA1          VTHVGFDNIEKAFMLMKDKPKDL-----------------------------------------------
1kolA1          NIAEVVGVQSLDDAPR------GYGEFDAGVPKKFVIDPHK-----------------------------
1uufA1          IRADQINEA-------------------------------------------------------------
1a71A1          TVVDELITHVLPFEKINEG--FDLLRSGESIRTI------------------------------------
1f8fA1          VKFYAFDEIN------------------------------------------------------------
1gv8A           EEKDEYELLCLDGTRQPVDSYKTCNWARVAA---------------------------------------
1e3jA1          THSFKLEQTVDAFEAARKKADNTIKVMIS-----------------------------------------
1vj0A1          PL--------------------------------------------------------------------
1gu7A1          GKPNGLTDAKSIETLYGTKPLHELYQDGVANSKD------------------------------------
1v3tA1          ----------------------------------------------------------------------
1qorA1          ----------------------------------------------------------------------
1o89A1          SLSEAPNFAE------------------------------------------------------------
1e0tA3          ----------------------------------------------------------------------
1escA           SLGGNTLGFNRILKQCSDELRKPSLLPGDPVDGDEPAAKCG--EFFGTGDGKQWLDDQFERVGAELEE-L
1ynsA1          L---------------------------------------------------------------------
1h2bA2          PLADAGITAAVKKAARTLYPGAYVAIVGVGGLGHIAVQLLK-VMTPATVIALDVKEEKLKLAERLGADHV
1pqwA           TFGVAYLTAWHLCEVGRLSPGERVLIHSATGGVGMAAVSIA-KMIGARIYTTAGSDAKREMLSRLGVEYV
1bxzA2          MIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGA-GRIIAVGSRPVCVDAAKYYGATDI
1e3jA2          ALLEPLSVGVHACRRAGVQLGTTVLVIGAGPIGLVSVLAAKAYGA--FVVCTARSPRRLEVAKNCGADVT
1vj0A2          AMCSGATAYHAFDEYPESFAGKTVVIQGAGPLGLFGVVIAR-SLGAENVIVIAGSPNRLKLAEEIGADLT
1ztpA1          ALQTSGRPQLAITHHVLS-GKWLXHLAPGFKLDHAWAGIARAVV-EGRLQVAKVSPRAKEGGRQVICVYT
1iyzA1          ----------------------------------------------------------------------
1lluA2          PILCAGVTVYKGLKQTNARPGQWVAISGIGGLGHVAVQYARAMGLH--VAAIDIDDAKLELARKLGASLT
1vj1A1          -----KVKETVAKGLENXGVA-FQSXXTGGNVGKQIVC--------------------------------
2ck3H2          ----------------------------------------------------------------------
1v3tA2          TIGMPGLTAYFGVCGVKG-GETVLVSAAAGAVGSVVGQIAK--LKGCKVVGAAGSDEKIAYLKQIGFDAA
1kolA2          CLSDILPTGYHGAVTAGVGPGSTVYVAGAGPVGLAAAASAR-LLGAAVVIVGDLNPARLAHAKAQGFEIA
1o54A           TQIVYPKDSSFIAMMLDVKEGDRIIDTGVGS-GAMCAVLARAVGSSGKVFAYEKREEFAKLAESNLTKWG
1yb5A2          AIGIPYFTAYRLIHSACVKAGESVLVHGASGGVGLAACQIA-RAYGLKILGTAGTEEGQKIVLQNGAHEV
1a71A2          LIGCGFSTGYGAVKVAKVTQGSTCAVFGLGGAGLSVIMGCK-AAGAARIIGVDINKDKFAKAKEVGATEC
1txqA1          ----------------------------------------------------------------------
1iyzA2          AFPVSFLTAYLALKRAQARPGEKVLVQAAGALGTAAVQVAR--AMGLRVLAAASRPEKLALPLALGAEEA
1a9xA3          ----------------KRTDIKSILILGAGPIVIGQACEFD-YSGAQACKALREEGYRVINVNSNPATIM
1o89A2          ------------DAGVRPQDGEIVVTGASGGVGSTAVALLHKLGY--QVVAVSGRESTHEYLKSLGASRV
1ixkA           ----------------DPKPGEIVADXAAAPGGKTSLAQLXR--NDGVIYAFDVDENRLRETRLNLSRLG
1omoA           TSLRTGAAGGIAAKYLARKNSSVFGFIGCGTQAYFQLEALRRVFDIGEVKAYDVREKAAKKFVSYCEDRG
1piwA2          ------------------------------------------------TYVISRSSRKREDAMKMGADHY
1b6rA2          ------------------------CVLGNGQLGRMLRQAGEP--LGIAVWPVGLDAEPAAVPFQQSV---


                         .         .         .         +         .         .         .:280
query           LNNGQHSLAEFLQQKALKPTLIVDAACHPAILQEAITLASPAARIVLMGFSSDPCEIVQQGITGKELAIY
1bxzA1          ----------------------------------------------------------------------
1kolA1          ----------------------------------------------------------------------
1uufA1          ----------------------------------------------------------------------
1a71A1          ----------------------------------------------------------------------
1f8fA1          ----------------------------------------------------------------------
1gv8A           ----------------------------------------------------------------------
1e3jA1          ----------------------------------------------------------------------
1vj0A1          ----------------------------------------------------------------------
1gu7A1          ----------------------------------------------------------------------
1v3tA1          ----------------------------------------------------------------------
1qorA1          ----------------------------------------------------------------------
1o89A1          ----------------------------------------------------------------------
1e0tA3          ----------------------------------------------------------------------
1escA           LDRIGYFAPDAKRVLVGYPRLVPEDTTKC--LTAAPGQTQLPFADIPQDALPVLDQIQKRLNDGADFVDL
1ynsA1          ----------------------------------------------------------------------
1h2bA2          VDARRDPVKQVMELTRGRVNVAMDFVGSQATVDYTPYLLGRMGRLIIVGYGGEL-RFPTIRVISSEVSFE
1pqwA           GDSRSVDFADEILELTDGYGVVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVYADASLSVVDLDLNLKL
1bxzA2          VNYKDGPIESQI--MNLTEGKGVDAAINADIMATAVKIVKPGGTIANVNYFGEGEVLLEWGCGMAHKTIK
1e3jA2          LVEEESSIIERIRSAIDLPNVTIDCSGNEKCITIGINITRTGGTLMLVGMGSQMVTVPLVNACAREIDIK
1vj0A2          LNRRETSVEERRKTHGRGADFILEATGDSRALLEGSELLRRGGFYSVAGVAVPQDPVVYEWLVLKNATFK
1ztpA1          DDFTDRLGVLEADSAIRAAGIKCLLTYPDVYTYLGIYRANRWHLCPTLY---------------------
1iyzA1          ----------------------------------------------------------------------
1lluA2          VNARQEDPVEAIQRDIGGAHGVLVTAVSNSAFGQAIGMARRGGTIALVGLPPGDFPTPIFDVVLKGLHIA
1vj1A1          ----------------------------------------------------------------------
2ck3H2          ----------------------------------------------------------------------
1v3tA2          FNYKTVNLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGPGPSPESIIYKQLRGFIVYRW
1kolA2          DLSLDTPLHEQIAAGEPEVDCAVDAVGFEAVLNSLMQVTRVAGKIGIPGLYVTE-----DPGAVDAAAKI
1o54A           LIERVTIKVRDISEGFDEKDLFLDVPDPWNYIDKCWEALKGGGRFATV------------CPTTNQVQET
1yb5A2          FNHREVNYIKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTI-EINPRDTMAKESSII
1a71A2          VNPQDYKPIQEVLTEMSNGGVDFSFEVIGTMVTALSCCQEAYGVSVIVGVPDSQNLSMNPMLLLSGRTWK
1txqA1          ----------------------------------------------------------------------
1iyzA2          ATYAEVPERAKAWGGLD-----LVLEVRGKEVEESLGLLAHGGRLVYIGAAEAPIPPLR--LMRRNLAVL
1a9xA3          TDPEMADATYIEPIEKERPDAVLPTMGGQTALNCALELE-RQGVLEEFGV--------------------
1o89A2          LP---RDEFAESRPLEKQVWAGAIDTVGDKVLAKVLAQMNYGGCVAACGLAGGFLPTTVMPFILRNVRLQ
1ixkA           VLNVILFHSSSLHIGELNVEILLDAPCQXRLLEKGLEVLKPGGILVYSTCSLEPEE--------------
1omoA           ISASVQ------PAEEASRCDVLVTTTPSRKPVVKAEWVEEGTHINAIGADGPGKQELDVEILKKAKIVV
1piwA2          IATLEE--GDWGEKYFDTFDLIVVSSLTDIDFNIMPKAMKVGGRIVSISIPEQHEML-------------
1b6rA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SSRLNANKFPVVIDWLNKGLIDPDKLITHTFDYQHVTDAIELFEKDQxxxxxxxxxxxx
1bxzA1          -----------------------------------------------------------
1kolA1          -----------------------------------------------------------
1uufA1          -----------------------------------------------------------
1a71A1          -----------------------------------------------------------
1f8fA1          -----------------------------------------------------------
1gv8A           -----------------------------------------------------------
1e3jA1          -----------------------------------------------------------
1vj0A1          -----------------------------------------------------------
1gu7A1          -----------------------------------------------------------
1v3tA1          -----------------------------------------------------------
1qorA1          -----------------------------------------------------------
1o89A1          -----------------------------------------------------------
1e0tA3          -----------------------------------------------------------
1escA           YAGTGANTACDGADGIGGLLEDSQLELLGTKWYAHPNDK--------------------
1ynsA1          -----------------------------------------------------------
1h2bA2          GSLVNYVELHELVTLALQG----------------------------------------
1pqwA           QPARYRQLLQHILQHVADGKLEVLPV---------------------------------
1bxzA2          GGLCPGGRMERLIDLVFYK----------------------------------------
1e3jA2          SVFRYCNDYPIALEMVASG----------------------------------------
1vj0A2          GIWVSDTSFVKTVSITSRNYQLLSKL---------------------------------
1ztpA1          -----------------------------------------------------------
1iyzA1          -----------------------------------------------------------
1lluA2          GSIVTRADLQEALDFAGEGL---------------------------------------
1vj1A1          -----------------------------------------------------------
2ck3H2          -----------------------------------------------------------
1v3tA2          QGDVREKALRDLMKWVLEG----------------------------------------
1kolA2          SLSIRFGLGWAKSHSFHTGQTPVMKYNRALMQ---------------------------
1o54A           LKKLQELPFIEVWESLFRRLRPVDRMVAHT---AYMIFATKVCRREE------------
1yb5A2          GVTLFSSTFQQYAAALQAGM---------------------------------------
1a71A2          GAFKSKDSVPKLVADFMAK----------------------------------------
1txqA1          -----------------------------------------------------------
1iyzA2          GFWLPLLREGALVEEALGFL---LPRLGREL----------------------------
1a9xA3          -----------------------------------------------------------
1o89A2          GVDSVMTPPERRAQAWQRADLPESFY---------------------------------
1ixkA           -----------------------------------------------------------
1omoA           DDLEQAKHGGEINVAVSKGVIGVEDVHA-------------------------------
1piwA2          -----------------------------------------------------------
1b6rA2          -----------------------------------------------------------