[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF66691.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ai4.1.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "2hydA2.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1pf4A2.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1ps9A1.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1tpzA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1bifA1.bssp"
#ERROR : Can't open dsspfile "1gqtA.bssp"
#ERROR : Can't open dsspfile "1zd9A1.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "2cxxA1.bssp"
#ERROR : Can't open dsspfile "1a2kC.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1xzpA1.bssp"

## Summary of PDB Search
:588
    1e-33  17%  1ai4.1 [d.153.1.2] PENICILLIN AMIDOHYDROLASE A:- -- - B:- -- -
    8e-26  20%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-25  29%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-23  19%  2hydA2 [f.37.1.1] ABC TRANSPORTER HOMOLOG A:1 -- 323
    1e-22  31%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    2e-22  19%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    3e-22  17%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    3e-22  17%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    8e-22  21%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    5e-21  10%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    2e-19   8%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    6e-18  12%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    9e-18  11%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    2e-17  12%  1pf4A2 [f.37.1.1] TRANSPORT ATP-BINDING PROTEIN MSBA A:10 -- 320
    2e-16  11%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    4e-16  10%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    9e-16  13%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    2e-15   9%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    5e-15  12%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    6e-15   8%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    7e-15   6%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    8e-15   9%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    1e-14  15%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    1e-14  13%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    1e-13  10%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    1e-13   8%  1rkbA  [c.37.1.1] PROTEIN AD-004
    2e-13   6%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    3e-13  11%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    6e-13   7%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    8e-13  12%  1jb1A  [c.91.1.2] HPRK PROTEIN
    1e-12  13%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    2e-12   8%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    2e-12  10%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    2e-12  11%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    3e-12   9%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    5e-12  12%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    5e-12  13%  1t3wA  [a.236.1.1] DNA PRIMASE
    9e-12  16%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    1e-11   9%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    2e-11   4%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    3e-11   9%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    3e-11  10%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    3e-11  14%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    8e-11   8%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    1e-10  14%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    1e-10  10%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    2e-10  23%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    3e-10  11%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    3e-10   9%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    4e-10  10%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    6e-10  14%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    6e-10  11%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    6e-10  14%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    7e-10  11%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    2e-09  13%  1g6oA  [c.37.1.11] CAG-ALPHA
    2e-09   5%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    2e-09  12%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    3e-09  13%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    3e-09  12%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    4e-09  10%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    9e-09  15%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    1e-08  12%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    1e-08  13%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    1e-08  13%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    2e-08  11%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    2e-08  10%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    2e-08   9%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    3e-08  10%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    3e-08   8%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    3e-08  11%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
    5e-08   6%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
    7e-08  11%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    7e-08   9%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    9e-08   6%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    1e-07  21%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-07   8%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    1e-07  13%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    2e-07   9%  1jbkA  [c.37.1.20] CLPB PROTEIN
    2e-07  21%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    3e-07  11%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    3e-07  11%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    3e-07  11%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    4e-07  14%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    5e-07   9%  1mi8A  [b.86.1.2] DNAB INTEIN
    6e-07  10%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    6e-07   8%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    9e-07   7%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    1e-06   7%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    1e-06  16%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    1e-06   7%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    1e-06   9%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    2e-06   9%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    3e-06   9%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    3e-06  16%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    3e-06  10%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    5e-06   9%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    5e-06  10%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    8e-06  15%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    8e-06  12%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    9e-06  23%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    1e-05  13%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    1e-05  17%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    1e-05  15%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    1e-05  14%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    4e-05   9%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    5e-05  11%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    6e-05  16%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    7e-05  14%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    7e-05  14%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    7e-05  12%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    9e-05  31%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-04  14%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    1e-04  12%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    1e-04  53%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 -- 342
    1e-04  16%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    2e-04  12%  1ps9A1 [c.1.4.1] 2,4-DIENOYL-COA REDUCTASE A:1 -- 330
    2e-04  18%  1g31A  [b.35.1.1] GP31
    2e-04  28%  1tpzA  [c.37.1.8] INTERFERON-INDUCIBLE GTPASE
    2e-04  13%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    2e-04   8%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    2e-04  12%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    4e-04  19%  1bifA1 [c.37.1.7] 6-PHOSPHOFRUCTO-2-KINASE/ FRUCTOSE-2,6- A:37 --
    4e-04  15%  1gqtA  [c.72.1.1] RIBOKINASE
    6e-04  47%  1zd9A1 [c.37.1.8] ADP-RIBOSYLATION FACTOR-LIKE 10B A:18 -- 181
    6e-04  47%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    7e-04  11%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    7e-04  47%  2cxxA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB A:2 -- 185
    7e-04  41%  1a2kC  [c.37.1.8] RAN
    0.001  11%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    0.001  13%  1xzpA1 [a.24.25.1] PROBABLE TRNA MODIFICATION GTPASE TRME A:118 --
:588

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxRWLNISRLLGFMSGVLIVAQAWIMARILQHMIMENIPREAXXXXXXXXX
1ai4.1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1pf4A2          ---------------------AGLVVSTIALVINAAADTYMISLLKPLLDEGFGNA-ESNFLRILPFMIL
1e9rA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1ps9A1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1gqtA           ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXRAWVVWLRERVGFHAGQHIRFEIRRQVLDRLQQAGPAWIQGKPAGSWATLVLEQIDDMHDYYARY
1ai4.1          ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2hydA2          -----RPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQVISRVINDVEQTKDFILTG
1pf4A1          ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1pf4A2          GLMFVRGLSGFASSYCLSWVSGNVVMQMRRRLFNHFMHMPVRFFDQESTGGLLSRITYDSEQVAGATSRA
1e9rA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1ps9A1          -------FIIIYRLSMLDLVEDGGTFAETVELAQAIEAAGATIINTGIGWHEARIPTIATPVPRGAFSWV
1g31A           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1gqtA           -----------------------------ESVRQQLATDNITPVSVIKGESTGVALIFVNGEGENVIGIH
1zd9A1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LPQMALAVCVPLLIVAAIFPSNWAAALILLGTAPLIPLFMAMVGMGAADANRRNFLALARLSGHFLDRLR
1ai4.1          -----------------------------------------------ANDTWHLFYGYGYV--VAQDRLF
1q3hA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2hydA2          LMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYVFFGRLRKLTRERSQALAEVQGFLHERVQ
1pf4A1          ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1pf4A2          LVS-----------------------------------IVREGASIIGLLTLMFWNSWQLSLVLIVVAPV
1e9rA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1ps9A1          TRKLKGHVSLPLVTTNRINDPQVADDILSRGDADMV-----SMARPFL----------------------
1g31A           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1gqtA           AGANAALSPALVEAQRERIANASALLMQLESPLEAAKIAHQNKTIVALNPAPARELPDELLALVDIITPN
1zd9A1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GMETLRIFGRGEAETESIRAASQDFRQRTMEVLRLAFLSSGVLEFFTSLSIALVAVYFGFSYLGELNFGH
1ai4.1          QMEMARRSTQGTAEVLGKDFVKFDKDIRRNYWPDAIR------AQIAALSPEDMSILQGYAWIDKVN---
1q3hA           ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
2hydA2          GISVVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIGVGAYLAIGSITVG-
1pf4A1          ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1pf4A2          VAFAISFVSKRFRKISRNMQTAMGHRQQTMKLVSAQSIADPVIQMIASL--ALFAVLFLASVDAELTPGT
1e9rA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
2iqhA1          ---------------------------------------------------------------IRASVG-
1pv4A3          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhdA1          --------------------------------------------DLIQQFNQMIITMNGNEFQTGGIGNL
1ffhA2          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1ps9A1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1gqtA           ETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWEGQRVPGFRVQAVDT------------
1zd9A1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YGTGVTLAAGFLALILAPEFFQPLRDLGTFYHAKAQAVGAADSLKTFLETPLAHPARGEVELAENEPVTI
1ai4.1          TNPETLLPKQFNTFGFTPKRWEPFDVAMIFTMANRFSDSTSEIDNLALLTALKDKYGVSQGMAVFNQLKW
1q3hA           ------------------------------------------------------EEGFGELL-------E
1l7vC           ----------------------------------------------------------------------
2hydA2          -----TLAAFVGYLEL---LFGPLRRLVASFTTLTQSFASMDRVFQLIDED-------------------
1pf4A1          --------------------------------------------------------------AERVNGEV
1b0uA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1ji0A           -------------------------------------------------------------------IVL
1m3eA1          ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1pf4A2          FT---------VVFSAMFGLMRPLKALTSVTSEFQRGMAACQTL--------------------------
1e9rA           -----------------------------------------------------------LRGTRIVSG-G
2v3jA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
2iqhA1          -----KMIDGIGRFYIQ--MCTELKLSDYEGRLIQNSLTIERMVLSAFDTGGPIYRRVDGKWRRELILYE
1pv4A3          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhdA1          PIRNWNFDFGLLGTTLL--NLDANYVETARNTIDYFVDFVDNVCMDEMVRESQRNGIAPQS--DSLIKLS
1ffhA2          ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1ckvA           ------------------------------------------------------------------SVNS
1rkbA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1urjA           ------------------RHLDPSTQAPNL----TRLCERARRHFGFSDTPRPGDLKHETTGEARLGLDP
1mukA           ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1bmfA3          -----------------------------------VGEELLGRVVDALGNAIDGKGPIGSK--ARRRVGL
1bgxT2          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1g6oA           ---------------------------------------------------------------------F
2qgmA1          ----------------------------------------------------------------------
1g8yA           --------------------------------------------------------------------TH
2je6I3          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1c4oA1          --------------------------------------------------------------------TF
1q3tA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
2gtlM1          -----------------------------------------------------------------IVTIT
1vplA           ---------------------------------------------------------------------V
1cd5A           -------------------------------------------------TPMTTYKALVEMHKAGQ---V
2ancF1          ----------------------------------------------------------------------
1jbkA           ---------------------------------------------------------------YTIDLTE
1bs2A1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1mi8A           ------------------------------------------------------SGDSLISLASTGKR-V
1ak2A1          ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------DKPG-I
1uouA3          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1esmA           ---------------FDRNQWAALRD-------SVPXTLSEDEIARLKGIN------EDLSLEEVALPLS
1w1wA           ----------------------------------------------------------------------
1i1qA           -----------------------------------------------ARNDLARICTGSRYVADLTKDRY
1ovmA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1fl9A           ---------------------------------------------------------------------I
1ps9A1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1tpzA           --------------------------------------------------------------------IL
1dnpA2          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1gqtA           IAAGDTFNGALITALLEEK---PLPEAIRFAHAAATRKGAQPSVPW------------------------
1zd9A1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1xzpA1          -------------------------------------------VDSLRRELIEVLAEIRVELDYPDEIET


                         .         .         .         .         *         .         .:420
query           DAVNLIITSPEGKTLAGPLNFSLAAGERAVLVGRSGSGKSSLLNVLSGFLSYQGSLRINGVELRDLSPES
1ai4.1          LVNPSAPTTIAVQESNYPLKFNQQQTSNMWVIGKAQDAKAIMVNQFGWYYTYGIGLHGAGYDVTGNTPFG
1q3hA           KVSFSHLCLVGNPVLKN-INLNIEKGEMLAITGSTGSGKTSLLMLILGELESEGIIKHSGRVSFCSQFSW
1l7vC           ------------STRLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXTSGKGSIQFAGQPLEAWSATK
2hydA2          ----------------------------------------------------------------------
1pf4A1          DVKDVTFTYQGKEKPASHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDDSGSICLDGHDVRDYKLTN
1b0uA           -----------GHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSGAIIVNGQNINLVRDKD
1e69A           ------------------PSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKDMIFAGSENLPPAGSAY
1sgwA           -----------DKPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKLKGEIIYNGVPITKVKGKI
1ji0A           EVQSLHVYYGAIHAIKG-IDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRQKGKIIFNGQDITNKPAHV
1m3eA1          ------------------AVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKLTAVSNNAGVDNFGLGL
1t06A           ------------------ELEALGKERTKKIYISNGAHEPVFGVATGAMKPI-AKKIKLNQELAEELYAT
1nijA1          -------------------------IAVTLLTGFLGAGKTTLLRHILNEQGYKIAVIENEFGEVSVDDQL
1jalA1          -------------------------GFKCGIVGLPNVGKSTLFNALTKAGFCTIEPNTGVVPMPDPRLDA
1pf4A2          ----------------------------------------------------------------------
1e9rA           KLKRMTREKAKQVTVAG-VPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRDRMVIVDPNGDMLSKFG
2v3jA1          ------------------LTSKDKITKRXIVVLAXASLETHKIYVLLNCDDHQGLLKKXG---RDISEAR
1ex6A           --------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSGFSVSSTTRTPRAGEVN
2iqhA1          EIRRIWRQANNGDDATAGSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVME
1pv4A3          ------------------LASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNPDCVLXVLLIDERPEEV
2gx8A1          -------------------------------------------------------VRIETIIPASLQRKV
1khbA1          ------------------ITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVEVGDDIAWMKFDAQGH
1qhdA1          GIKFKRINFDNSSEYIENWNLQNRRQRTSVLADASETMLANVTSVRQEYAIPVGPVFPPGMNWTDLITN-
1ffhA2          ------------------RLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRPLLVAADTQRPAARE
1jjvA           -------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVVAKDSP-
1ckvA           NAYDAGIMKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYRAGYWWIKANGKIEVDCDE
1rkbA           ----------------------LMLLPNILLTGTPGVGKTTLGKELASKSGLK-YINVGDLAREEQLYDG
1kgdA           -------------------------RKTLVLLGAHGVGRRHIKNTLITKHPRFAYPIPHTTRPPEENGKN
1grqA           ------------------------TTRMIILNGGSSAGKSGIVRCLQSVLEPWLAFGVDSLIEAMPLKMQ
1l7lA           ------------------VLANNEAGQVTSIIYNPGDVITIVAAGWSYGPTQKWGPQGDREHPDQGLIC-
1jb1A           ------------------VLVDIY-GLGVLITGDSGVGKSETALELVQRGHRLADDRVDVYQQDEQTIVG
1urjA           DRALLYLVVTEG------FKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPYPLQLFMPDFSRVIAEPFN
1mukA           -----------------------------WRMCEAREPSVDLLPLCAGIDPLNSDPFLKMVSVGPM-LQS
1l1oA           ------------------GMLAQFIDKPVCFVGRLEKIHPTGKM-FILSDGEGKNGTIELMEPLDEEISG
1poiA           ---SKVMTLKDA------IAKYVHSGDHIALGGFTTDRKPYAAILRQGITDLTGLGGAAGGDWDMLIGNG
2yyeA2          -------------------QSGAQVGQLLILTKPIGTGILIKGLKEGILKEEDIALNDKARNLMLSLDAT
1ii8.1          ----------------------------------------------RTERERVKKEIKDLEKAKDFTEEL
1t3wA           --------------------------------------KRTTXRILIGLLVQNATLVPPLENLDENKLPG
1yvuA2          ------------------------------------------------------------VFLEFLLYDF
1mjgM           --------DLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGKIEVIGPDIDQIPEGS
2gk3A1          ----------------------------------------------------------------------
1bmfA3          KAPGIIPRISVREPMQTDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKFNDGTDEKKKLYCIYVAIG
1bgxT2          -------------------------------------------RGMLPLFEPKRVLLVDGH---------
1cr0A           ------------------KTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEET
1afrA           ------------------VTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWPQDFLPDPASDGFDEQV
1em8A           ----------------------------------------------------------------------
1udwA           -------------------------PFLIGVSGGTASGKSSVCAKIVQLLQQVVILSQDSFYRVLTSEQK
1f2t.1          ----------------------------------------------------------------------
2axpA1          -----------------------------ILEGPDCCFKSTVAAKLSKELKYPIKGSSFELAKSGNEKLF
1tljA           ------------------IYHDKEIGYLDPDILGFLLAFYRNRNDVYTQSSCSG--RITIVDAEMPWDRK
1tmkA           -----------------------GRGKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIGGLI
1zp6A1          ------------------------GGNILLLSGHPGSGKSTIAEALANLPGPKVHFHSDDLWGYI-KHGR
1viaA           --------------------------KNIVFIGFXGSGKSTLARALAKFLDSD----FLIEQKFNQKVSE
1vhhA           ----------------------------------------------------------------------
1qhlA           ------------------RTFDLDELVTT-LSGGNGAGKSTTMAAFVTALIPD----LTLLLHGKLKAGV
1g6oA           EEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDT-EEIVFKH
2qgmA1          ----------------------------------------------------------------------
1g8yA           KPINILEAFAAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLALQLAAQIAGGPDLLEVGELPTGPVIYL
2je6I3          ------------------IVIDIMPVKVPRVIGKNKSMY-ETLTSKSIFVANNGRIWAFSEEILIEAIRK
1ni3A1          ------------------QWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPNYPYATIDPEAVPDER
1jqjA3          ------------------VRLYVSENQLKITANNPEQEEAE----------EILDVTYSGAEMEIGFNVS
1e6cA           --------------------------EPIFMVGARGCGMTTVGRELARALGYEFDTDIFMQHTSGMTVAD
1a4iA2          ----------------------------------------------------------------------
1xbtA1          -------------------------GQIQVILGPMFSGKSTELMRRVRRFAQYKCLVIKYAKDTRALPAC
1c4oA1          RYRGPSPKGDQPKAIAG-LVEALRDGERFVLLGATGTGKTVTMAKVIEALGPALVLAPNKILAAQLAAEF
1q3tA           -------------------------TIQIAIDGPASSGKSTVAKIIAKDFGFT--YLDTGAMYRAATYMA
1atrA1          ------------------PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTPSYVAFTDTERLIGDAAKN
1es6A2          ----------------------------------------------------------------------
1n25A           ------------------MVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKA-LNVNLPLDRLNFELG
1o7d.2          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1pgsA2          ---GVPYGKAHTLGLKKNIQLPTNTYLRTTISGWGHAKPYDAGSRGCAEWCFTHTIAINNANTFQHQLGA
1v47A1          ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
2gtlM1          AAHRKSFFPNRVWLRATLYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSEGYGVICDFNLGDDDHA
1vplA           VVKDLRKRIGKKEILKG-ISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPHE
1cd5A           SFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDHLFMGGVGNDGHIAFN
2ancF1          -------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLLDIDWQG
1jbkA           RAEQGKLDPVIGRDEETIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALDMG
1bs2A1          ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1lw7A2          ----------------------PFFAKTVAILGGESSGKSVLVNKLAAVFNTTAWEYGREFVFEKLGGDE
1mi8A           SIKDLLDEKDFEIWAINEQTMKLESAKVS-RVFMTGKKLVYILKTRLGRTKATANHRFLTIDGWKRLDEL
1ak2A1          -------------------------GVRAVLLGPPGAGKGTQAPKLAKFCVCHLATGDMLRAMVASGSEL
1zbsA1          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------QDDVYLDITDRLCFAISR
1e3mA2          RITEGVVEQVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIAXAYIGSYVPAQKVEIGPIDR
1uouA3          ----------------------------------------------------------------------
1zs3A1          --------------------------------------------------------------------YA
1s9hA           ------------------ATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGC-VNWTNENFPFNDCV
1np6A           -------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRKA
1dhyA1          ----------------------------------------------------------------------
1ckeA           -----------------------AIAPVITIDGPSGAGKGTLCKAMAEAL---QWHLLDSGAIYDVASEP
1f46A           -----------------------------------------IMNVAAHHGS-----ELNGELLLNS----
2f9hA1          --------------------------------------------------------------------TE
1l3aA           ---------------------------------------------------FVGYSIYKGKAALTVEPRS
1p5zB           -------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTN
1esmA           RLLNFYISSRQAVLEQFLGTNGQRIPYIISIAGSVAVGK-------------------------------
1w1wA           ------------KSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVLKDLIYRGPQ--------
1i1qA           SYVMHLVSRVVGELRHD-LDALHAYRACMNMGTLSGAPKVRAMQLIADAE--------------GQRRGS
1ovmA2          -------------------DGYARCKGFAALLTTFGVGELSAMNGIAGSYAHVPVLHIVGAPGTAAQQ--
2vnuD1          -----------------PTTHKYPLGHFVRDLGTIESAQAETEALLLEHD--------------------
2vgmA3          ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1g8fA3          -------------------------GFSIVLGNSLTVSREQLSIALLSTFLQFG----GGRYYKIFEHNN
1yr6A1          -----------------------------VFVGTAGSGKTTLTGEFGRYLEDNKVAYVNLDTGVKELPYE
1yj5A2          ---------PESSSLLSP------NPEVVVAVGFPGAGKSTFIQEHLVSAYVHVNRDTLGSWQRCVSSCQ
1odfA           ------------------------------FSGPQGSGKSFTSIQIYNHL------------MEKYGGEK
2pa7A1          ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
2gujA1          ----------------------------------VKKGSDPYFTLQAVLDSGRGTERVYDVNFDSAKIAS
1lnzA2          -----------------------------GLVGFPSVGKSTLLSVVSS----------------------
1fl9A           PDEFSMLRFGKKFAEIL-LKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGI--------------------
1ps9A1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1tpzA           NLIELRMRKGNIQLTNSAISDALKEIDSSVLTGETGSGKSSFINTLRG----------------------
1dnpA2          ----------------------------------------------------------------------
1tueA           ------------------FLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQG-AVISFVNSTSHFWLEPL
1e2hA           ----------------------MPTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETAN
1bifA1          -----------------------------VMVGLPARGKTYISKKLTRYLNFI------GVPTREFNVGQ
1gqtA           ----------------------------------------------------------------------
1zd9A1          -----------------------------TLVGLQYSGKTTFVNVI------------------------
1mkyA1          -----------------------------LIVGRPNVGKSTLFNKLVK----------------------
3cddA1          ----------------------------------------------------------------------
2cxxA1          -----------------------------IFAGRSNVGKSTLIYRL------------------------
1a2kC           -----------------------------VLVGDGGTGKTTFVKRH------------------------
1dwmA           ----------------------------------------------------------------------
1xzpA1          NTGEVVTRLERIKELTEELKKADAGILLNRGQEIFERGSDSLITNLRQKQLLAIKSLKEGMPVDMASIDL


                         .         .         +         .         .         .         .:490
query           WRQHLSWVGQNPQLPAATLRENVLLARPDASEQELYAALDAAWVSEFLPLLPQGVDTPLGNHASRLSVGX
1ai4.1          HNGVISW---------------------------------------------------------------
1q3hA           IMPGTIKENIIFGVSYDEYRYKS--------------VVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQ
1l7vC           LALHRAYLSQQQTPPFATVWHYLTLHQHDKTRTELLNDV----------AGALALDDKLGRSTNQLSGGE
2hydA2          ----------------------------------------------------------------------
1pf4A1          LRRHFALVSQNVHLFNDTIANNIAAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGGQ
1b0uA           GQLKVADKNQLRLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYP---VHLSGGQ
1e69A           VELVFEENGEEITVARELKRTGENTYYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSGGV
1sgwA           FFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEIMDALES------------VEVLDLKKKLGELSQGT
1ji0A           INRGIALVPEGRRIFPELTVYENLXXGAYNRKDKEGIKRDLEWIFSLFPRL----KERLKQLGGTLSGGE
1m3eA1          LLQSISSYVGENAEFERQYLAGEL-EVELTPQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGSPIKYNK
1t06A           GNYDAMYFAGIIADPKAMSESDFDRWIDGAYFYMLSDYVVAVTLSESNIAQDVADKWIAS---GDELKMS
1nijA1          IGDRATQIKTLTNGCICCSRSNEL----EDALLDLLDNLDKGNIQ----FDRLVIECTGMADPGPIIQTF
1jalA1          LAEIVKPERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAI----GHVVRCFENIDPLDDIDTI
1pf4A2          ----------------------------------------------------------------------
1e9rA           RDKDIILNPYDQRTKGWSFFNEI----RNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRE--TAKKLA
2v3jA1          PDITHQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLXVQLLHKLSIRSEEKLLK
1ex6A           GKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVS-------KSGKTCILDIDMQGVKSVKA
2iqhA1          LIRMIKRGINRRTRIAYRMCNILKGKFQTAAQRTMV---DQVRESRNPGNAEFEDLIFLARSALILRGSV
1pv4A3          TEXQRVKGEVVASTFDEPASRHVQVAEXVIEKAKRLVEHKKDVIILLDSITRLA-RAYNTVVPAVL----
2gx8A1          IKAMVTAHPYEEVAYDVYPLDNKGETLGLGKIGYLQEEMTLGQ-------FAEHVKQSLDVKGARVVGKL
1khbA1          LRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLASGVTITSWKN--KE
1qhdA1          -YSPSREDNLQRVFTVASIRSMLV----------------------------------------------
1ffhA2          QLRLLGEKVGVPVLEVMDGESPESIRRRV---------------------EEKARLEARDLILVDTAGRL
1jjvA           LLSKIVEHFGAQILNRAALRER-----------------VFNHDEDKLWLNNLLHPAIRERMKQKLAEQT
1ckvA           ISELLGRQFNVYDFLVDVSSTIG---RAYTLGNKFTITSELMGLDRKLEDY-------------------
1rkbA           YDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPEFHIVFVLRTDTNVLYERLETRGYNEKKLTD
1kgdA           YYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAI------------LDVEPQALKVL
1grqA           SAEGGIEFDADGGVSIGPEFRALEGAWAEG-----VVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLD
1l7lA           HDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIG----------
1jb1A           AAPPILSHLLEIRGL--GIIDVXNLFGAGAVREDTTISLIVHLENWTPD--QLIFDVPVPKITVPVKVGR
1urjA           RSIGEKFTYPLPFFNRPAVVGPAAVA---LRSRNVDAVARAAAHLAFDENHGAALPADITFTAFAGGFEQ
1mukA           TRKYFAQTLFMAKTVSGNAIDSALLRLRTLG----ADKKALTAQLLMVGLQESEADALAGK----IMLQD
1l1oA           IVEVVGRVTAKATILCTSYVQF-KEDSHPFDLGLYNEAV------KIIHDFPQFYPLGI-----------
1poiA           RVKAYCYTANSVTNVSRRFRKWFEAGKLDYSQDVIYMMWHAAALGLPFLPVTLMQGSGLTDEWGISKEVR
2yyeA2          ACTDVTGFGLLGHAWNICKNSNI-GARIFFEKVPYYQL--SENLVKKKIYPKGAIENLNFVKNYLKSNLD
1ii8.1          IEKVKKYKALARESKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGL
1t3wA           LGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEK------------LSXWDDIADKNIAEQTFT-DS
1yvuA2          VLLKKXIPSQVILNRLKFVLLNVAEQ----------VLAKTGNIPYKLKEIEGKVDAFVGIDISRITRDG
1mjgM           KLPLGILVDIYGRKMQADFEGVLERRIHDFINYGEGLWHTGQRNINW-------LRVSKDAVAKGFRFKN
2gk3A1          -------LFIGESWIHXIHSKGYDSFKYEEGATWLLECLRKGGVDIDYXPAHTVQIAFPESI----DELN
1bmfA3          QKRSTVAQVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAY
1bgxT2          -----HLAYRTFHALKGLTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRA
1cr0A           AEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDR---LLAKLAYMRSG-
1afrA           RELRERAKEIPDDYFVAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSPYLGFIY
1em8A           ----------------------------------------------------------------------
1udwA           AKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPYDFVSHSRKEETVTVYPADVVLFEGILAFYSQE
1f2t.1          --------------------------------------VRAEENKVRLFVVWEGKERPLTFLSGRIALGL
2axpA1          EHADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVREGKDI
1tljA           NSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIET-GWDILKIAREAGFKHSGILATN
1tmkA           NEYLTDDSFQLSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYV-------YSGVAYSAAKGTNGMD
1zp6A1          IDPWLPQSHQQNRXIXQIAADVAGRYAKEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTAAE--AIE
1viaA           IFEQKRENFFREQEQKXADFFSSCEKACIATGGGFVNVSNLEKADFEYLKKRLDKDEISKRPLFYDEIKA
1vhhA           -------------------------------------------------VAEKTLGASGRYEGKITRNSE
1qhlA           CYSMLDTINSAGRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPLNELKDKLEAMEYHSLMFDL
1g6oA           HKNYTQLFFGGNITSADCLKSCLRXRPD----RIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEL
2qgmA1          -----------------------------------------SVQKNIVKSIQSQANPL----KTIEPSKP
1g8yA           PAEDPPTAIHHRLHALGAHLSA-----------------EERQAVADGLLIQPLIGSLPNIMAPEWFDGL
2je6I3          IENE------------------------------------------------------------------
1ni3A1          FDWLCEAYKPKSRVPAFLTVFDIAGLTKGASTGVGLGNAFLSHV-RAVDAIYQVVRAFDDAEIIHVEGDV
1jqjA3          YLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAY----------------------------------
1e6cA           VVAAEGWPGSEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELALRLQASLQAPTLTG
1a4iA2          ----------------------------------------------------------------------
1xbtA1          LLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGK--------------------------------
1c4oA1          RELFPENAVEYFISYYDYYQPE------AYVPGKDLYIEKDASINPEIERLRHSTTRSLDVIVVASVSAI
1q3tA           LKNQHPISFGRSETGDQLVFVGDVDITHPIRENEVTNHVSAIAAIPEVREKLVSLQQEIAQQGGIVMDG-
1atrA1          QVAMNPTNTVMKHWPFMVVNDAGRPKVQVEYKGETKSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQ
1es6A2          --------------PGISFHPKL---RPILLPNKNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIE
1n25A           VAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLQIFPPGIVTMNEYSVPKTLQARF
1o7d.2          ----------------------------------------------------------------------
1jqjA2          --------------------SEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATD
1pgsA2          LGCSANPINNQSPGNWTPDRAGWCPGMAVPTRIDVLNNSLTG----------------------------
1v47A1          ----------------------------------------------------------------------
1j1zA2          -----------------SMDANLLHISYEGGAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGPVAVNGER
2gtlM1          VVPSSLFVCAHFNA--------------------------------------------------------
1vplA           VRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATE----IAGLGEKIKDRVSTYSKGM
1cd5A           EPASSLASRTRIKTLTHDTRVANSRFFDNDVNKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCV
2ancF1          AQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAVAEMSHYAEYDYLIVNDDFDTALTDL
1jbkA           ALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNMLKPALARGELHCVGATTLDEY
1bs2A1          --------------------------------------------------------------HSRLRSVE
1gm5A1          -------------FLWGEALPTLLEEFLNEVEKMLKNQVNTRRIHQLLKELDDPLLEN-----KDLEEKL
1f8xA           ----------------------------------------------------------IYFGAGWFTDRQ
1mm8A           ----------DPRRTARLVNVAAQLAKYSGKSITISSEGSKAAQEGAYRF----IRNPNVSAEAIRKAGA
1lw7A2          QAMQYSDYPQXALGHQRYIDYAVRHSH---------------------KIAFIDTDFITTQAFCIQYEGK
1mi8A           SLKEHIALPRSDISWDSIVSITETGVE-------------------------------------------
1ak2A1          GKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSI
1zbsA1          --------------------EGIACI-------LGTGSNSCLFDGREIKANVSPLGYILGDEGSGAVLGR
1ohcA1          PKSASNVHYFSIELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKI----------VHFTGSDQ
1e3mA2          IFTRVGFXVEXTETA-------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1zs3A1          KELDKAEIDHHKPTAGAHVLSNLFIENIRLTQAGIYAKSPVCEYLREIAQREVEYFFKISD----LLLDE
1s9hA           -DKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQ--------IDPTPVIVTSNTNMCAVIDGN
1np6A           GAAQTIVASQQRWALMTETPDEE-------------------ELDLQFLASRMDTSKLDLILVEGFKHEE
1dhyA1          ----------------------------------------------------------------------
1ckeA           LASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIAD---
1f46A           -IQQAGFIFGDMNIYHHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGD---ELQLF
2f9hA1          IGKHAIDDSEKXIIFGETATDTLKQHAVIQSFPE-KDQVTLAEGDHLKIGDTNYTITKVGS----FANSN
1l3aA           PEFSPLDSGAFKLSREGMVMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSII--SLGTKDSCEFHDPNKGR
1p5zB           GGNVLQMMYEKPERWSFTFQTYACLSR-------------------------------------------
1esmA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1i1qA           YGGAVGYFTAHGLDTCIVIRSALVENGIATVQAGAGIVLDSVPQSEADE-TRNKARAVLRAIATAHH---
1ovmA2          RGELLHHTLGDGEFHFYHMSEPITVAQAVLTEQNACYEIDRVLTTMLRERRPGYLMLP------------
2vnuD1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1d8jA           ----------------GSSGYKF------GVLAKIVNYMKT--RHQRGDTHPLTLDE-ILDETQHLDIGL
1g8fA3          KTE----LLSLIQDFI-------GSGSGLIIPDQWEDDKDSVVGKQNVYLLDTSSSADIQLESADEPI--
1yr6A1          PSIDVREFVTVEEIMREGYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTP------------
1yj5A2          AALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFREXTDPSHAPVSDXVXF
1odfA           SIGYASIDDFYLTHEDQLKLNEQFKNNKLLQGRGLPGTHDMKLLQEVLNTIFNQDTVVLPKYDKSQFKGE
2pa7A1          --------------------------------------------------TKGEEPRGFHAHLEQVLVCL
1g6hA           ----------------------------------------------------------------------
1iioA           --------------------SHMKMGVKEDIRGQIIGALAGADFPELMAALPNGPDTTCKSGDVELKASA
2gujA1          LDEEVPFTFEDFDV--------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1ps9A1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1dnpA2          --------------QDLRLHDNLALAAACRNSS----------------ARVLALYIATPRQWATHNMSR
1tueA           TDTKVAMLDDATTTCWTYFDTY------------------------------------------------
1e2hA           IYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRH--------
1bifA1          YRRDMVKTYKSFEFFLPDNEEGLKIRKQCALAA-------------------------------------
1gqtA           ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
3cddA1          -----------------------------ASKTKAGVSLILGDNVKAARGRFSWRQRFSKF----TIKAA
2cxxA1          ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1xzpA1          ERALNLLDEVTGRSFREDLLDTIFSN--------------------------------------------


                         *         .         .         .         .         +         .:560
query           XXXXXXXXXXXNPCQLLLLDEPAASLDAHSEQRVMQALKAASKRQTTLMVTHQLEDLADWDAIWVMQDGA
1ai4.1          ----------------------------------------------------------------------
1q3hA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTILVTSKMEHLRKADKILILHQGS
1l7vC           WQRVRLAAVVLQAGQLLLLDEPXNSLDVAQQSALDKILSACQQGLAIVXSSHDLNHTLRHHRAWLLKGGK
2hydA2          ----------------------------------------------------------------------
1pf4A1          RQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEILVVDEGE
1b0uA           QQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQLAEEGKTMVVVTHEMGFARHVSHVIFLHQGK
1e69A           GLALLFALMEIKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVITHNKIEAADLLHGVTMVNG-
1sgwA           IRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIISSREELS-YCDV--NENLHKYS
1ji0A           QQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTLLVEQALGALKVAHYGYVLETGQ
1m3eA1          DGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKADQAGNVTFRKSARNFNLPXCKAETTVVEVEE
1t06A           AGWSCYCWLLGNRKDNAFSESKISDMLEMVKDTIHHSPERTKSAMFLNTVAIHEKAVEIAKEVGIVEVKR
1nijA1          FSHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQVGYADR--ILLTKTDVAGEAEKLERLARINARA
1jalA1          NTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENAGMIGLDKEELQAIKSYNFLTLKP
1pf4A2          ----------------------------------------------------------------------
1e9rA           LIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNSKALTSARFVLSDKLPHVTMPDGDFSIRSWL
2v3jA1          VIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLDDDESICVFVGAXARGKDNFADEYVDEKVGLSNYP
1ex6A           IPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAEHDKVIVNDDLDKAYKEKDFIFAE---
2iqhA1          AHKSCLPACVYGSAVASGYDFEREGYSLVGIDPFRL-----LQNSQVYSLIRPNENPAHKQLVWMACHSA
1pv4A3          ----------TGGVDANALHRPKRFFGAARNVEEGGSLTI---IATALIDTGSKXDEVIYEEFKGTGNXE
2gx8A1          DDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLNIVDPGHNVEKVMKQKQLQEKVDAK
1khbA1          WSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAM
1qhdA1          ----------------------------------------------------------------------
1ffhA2          QIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVTGLVLTKLDGDARAALSARHVTGKP
1jjvA           APYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRIMNSQVSQQERLKWADDVINNDAEL
1ckvA           ----------------------------------------------------------------------
1rkbA           NIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDH------------------
1kgdA           RTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIR-----------
1grqA           VLWVGV------RCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVDVEVDTTHKESIECAWAI-------
1l7lA           ----------------------------------------------------------------------
1jb1A           NLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLIEH----------------------------------
1urjA           RLASVMAGDAALALMAVFDEPPTDISAQDTAAARANAVGAYLARAAGLVGAMVFSTNSALHLTEVDDAG-
1mukA           VNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRNTDIPPRMGWLRAI---------LRFLGAGM
1l1oA           ----------------------------------------------------------------------
1poiA           KTLDKVPDDKFKYIDNPFKP--------------------------------------------------
2yyeA2          NWKLILLSDPVTSGGLLFTINKE------KLEKIDETAKELEVNYWIIETIA------------------
1ii8.1          AFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQILVSHDEELKDAADHVIRISLEN
1t3wA           LNHXFDSLLELRQ-EELIARERTHGLSNEERLELWTLNQELAK---------------------------
1yvuA2          KTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAIG-------DVFSLLEKLGFKKGSKIVVHRDGR
1mjgM           YGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKERMRGLTDETVDTFYSCNHVCIVTPER
2gk3A1          RYDVIVISDIGSNTFLLQNETFYQLKIKPNALESIKEYVKNGGGLLXIGGYLSFXGIEAKANYKNTVLAE
1bmfA3          RQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGVSAYIPTNVISITDGQ
1bgxT2          PTPEDFPRQLAIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEEVRILTADKDLYQLLDRIHVLHPEG
1cr0A           -----------LGCDVIILDHI--SIRKMIDNLMTKLKGFAKSTGVVLVVICHLKDLLRQLSIIALERNQ
1afrA           TSFQERATFISHGNTARQAKEHGDIKLAQICGTIAAD-----EKRHETAYTKIVEKLFEIPDGTVLAFAD
1em8A           --------------TFYLLDNDTTVDGLSAVEQLVCEIAAERWRSRVLIACEDEKQAYRLEALWARPAES
1udwA           VRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADN
1f2t.1          AFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERLKKIPQVILVSHELKDAADHVIRISLENG-
2axpA1          DSILELYREVXSNAGLHTYSWDTGQWSDEIAKDIIFLVE-------------------------------
1tljA           QKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNELARGKQKMNLLK--DLLS------------
1tmkA           LDWCLQPDVGLLKPDLTLFLSTQFGDERYETVKFQE-------KVKQTFMKLLDKEIRKGESITIVDVTN
1zp6A1          RCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQSGRFR------------
1viaA           KKLYNERLSKYEQKANFILNIENKNIDE-LLSEIKKVIK-------------------------------
1vhhA           RFKELTPN---YNPDIIFKDEENTGADRLMTQRCKDKLNANQWPGVKLRVTEGWDEDGHHSEESLHYEGR
1qhlA           GIIARRLRSASDRSKFYRLIEAYGGISSAITRSLRDYLLP------------------------------
1g6oA           ANXSSSNSAARNIKFESLIEGFKDLID-----------------XIVHINHHKQCD--------------
2qgmA1          FEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEEDWGNGLKLNEYIQTGKG
1g8yA           KRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAADTGCSIVFLHHAVLVDNIRSYLSSMTSAE
2je6I3          ----------------------------------------------------------------------
1ni3A1          DPIR----------DLSIIVDELLIKDAEFVEKHLEGLRKITSR--------------------------
1jqjA3          ----------------------------------------------------------------------
1e6cA           RPIAEEMEAVLREREALYQDVAHYVVDATQPCELMQTMR-------------------------------
1a4iA2          --------------AEILNGKE---ISAQIRARLKNQVTQLKEQVFTPRLAILQVGNRDDNLYINVKLKA
1xbtA1          ----------------------------------------------------------------------
1c4oA1          YGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIEKELWERVRYFEERGEVLYAQRLKERTL----
1q3tA           ----------RDIGTVVLPQALKIFLVASVDERAERRYKENIAKGIETDLETLKKEIAARDYK-------
1atrA1          RQATKDAGTIAGLNVLRIINEPTAAAIAYGLDK-------------------------------------
1es6A2          VPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQCDTCHSPASL--------------------
1n25A           VKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAAQSIQSRIVEWKERLKEFSLSVYQK
1o7d.2          --------------VYLVKDPGGKIVPSDVVTIPSSDSQELLFSALVPAVGFSIYSVSQMPRDLVIQNER
1jqjA2          GHRLAVCSMPIGQ----SLPSHSVIVPRKGVIELMRMLDGGDNP-LRVQIGSNNIRAHVGDFIFTSK---
1pgsA2          ----------------------------------------------------------------------
1v47A1          ----------------NLATGAFFPVKGFMTREEALSVAHEMRLPTGEPILLQFREKPRVNTVALLHGGE
1j1zA2          LSPAALL----QRLNEIGGRHGVGRVDIVENRFVGMKSRYETPGGTILYHARRAVESLTLREVLHQRDML
2gtlM1          ----------------------------------------------------------------------
1vplA           VRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTVSSHNMLEVEFLCDRIALIHNGT
1cd5A           NHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIK--------------------------
2ancF1          KTIIRAERLRMSR-QKQRHDALISKLLA------------------------------------------
1jbkA           RQYIEKDAALERRFQKVFVAEPSVEDT-------------------------------------------
1bs2A1          RNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLT-HQVSSCYDVLW
1gm5A1          QAFLD------YVKEIPNLPEARKRYRIQKSLEMIEKLR-------------------------------
1f8xA           NKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKATATYNNDLNGIKTNDIMLGVYIPD
1mm8A           MQTVKLA----QEFPELLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWWVHSVLLLEATFRTVGLLHQE
1lw7A2          AHPFLDSXIKEYPFDVTILLKN------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          PDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRGSAIDASQTPDVVFA-SILAAFSKAT
1zbsA1          LFIGSLLKGQX---PEGLCEAFLQEYGLTSADIIESVYRKPFPNRFLAGFSPFIAQHLDIPAVYSLVQNS
1ohcA1          RKQANAAFLVGCYMVIYLGRTPEEAYRILIFGESYIPFRDAAYGSTLLDCFHAVK---------------
1e3mA2          ----------------------------------------------------------------------
1uouA3          ----------------------------EQEELLAPADGTVELVRPLALVLHELGALRLGGAELLVDVGQ
1zs3A1          NEIVPSTTEEFLKYHKFITEDPKAKYWTDEDLSFIVDFQAQNMITRAIKLANKEEKFALAAGVVELYGY-
1s9hA           STTFEHQQPLQDRMFKFELTRRLDHDFGKTKQEVKDFFRWAKDHVVEVEHEFYV----------------
1np6A           IAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVADFVVEWMQK---------------
1dhyA1          ---------------IAVQPGELDDLAYAGLEVDDAAALERMADKAGVAFTRGDE-ALMQQRKVMGLLCL
1ckeA           --------GRDMGTVVFPDAPVKIFLDASSEHRRMLQLQVKGFSVNFERLLAEIKLVPAADALVLDSTTL
1f46A           KLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDA--------------------------
2f9hA1          LQSIAHSTLIFADAPTDEDDVIRNGVYLTPHQLPKITIG-----TTIDYL--------------------
1l3aA           SDEGRVRKVL---KVEPLPDGSGHFFNLSVQNKLINLDEPVTKAEFAVLVSA------------------
1p5zB           ----------------------------------------------------------------------
1esmA           -----------------------VLQSGXDYPHDPHHVFVSDFVDFSVDAPEDLLQTWYINRFLKFREGA
1w1wA           -----------QPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQIVISLK-----------------
1i1qA           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
2vgmA3          --------------YLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKLVLSTLHSLLDQLTGIACILKYP
1d8jA           KQKQWLMTEALNNPKIEVIDGKYAFKPKYNVR--------------------------------------
1g8fA3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1yj5A2          SYRKQFEPPTLAEGFLEILEIPFRLQE--HLDPALQRLYR------------------------------
1odfA           GDRCPTGQKIKLPVDIFILEGW------------------------------------------------
2pa7A1          NGSCRVILDDGNIIQEITLDSPAVGLYVGPAVW-HEMHDFSSDCVMMVLASDYYDETDYIQYDNFKKYIA
1g6hA           ---------------------------------------------TFLIIEHRLDIVLNIDHLYVMFNGQ
1iioA           GQVLTADDFPFKSAEEVADTIV------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1ps9A1          ----------------------------------------------------------------------
1g31A           --------------YVILVSEPAQAGDEEVTESGLIIGKRVQGEVPELCVVHSVGPDVP-EGFCEVGDLT
1tpzA           ----------------------------------------------------------------------
1dnpA2          QAELINAQLNGLQIALAEKGIPLLFREVDDFVASVEIVVCAENSVTHLFYNYQYEVNERADVEVERALRN
1tueA           ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1gqtA           ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
3cddA1          KADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRKSNXAEYTVTGWRIPQTGKLWNINTLVPVIDE-
2cxxA1          ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1dwmA           -----------------------------SGNMAAATVERENRNVHAVLKEGSATKDFRCDRVWVIVNDH
1xzpA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           IVEQGSYAELSAANGAFATLLAHRQEDI
1ai4.1          ----------------------------
1q3hA           SYFYGTFSELQSLRPDFSSKLMGYDTFD
1l7vC           XLASGRREEV------------------
2hydA2          ----------------------------
1pf4A1          IIERGRHAD-------------------
1b0uA           IEEEGDPEQVFGQSPRLQQFLKGSLKKL
1e69A           ----------------------------
1sgwA           ----------------------------
1ji0A           IVLEGKASEL------------------
1m3eA1          IVDIGSFAPE------------------
1t06A           DNKKSSLLNASE----------------
1nijA1          PVYTVTHGDI------------------
1jalA1          TMYIANVNEDGFENNPYLDRVREIAAK-
1pf4A2          ----------------------------
1e9rA           EDPNG-----------------------
2v3jA1          LSASVACSKF------------------
1ex6A           ----------------------------
2iqhA1          AFEDLRVSS-------------------
1pv4A3          LHLSRKIAEK------------------
2gx8A1          KLNVHIHASQLHTDP-------------
1khbA1          RSEAKIIMHD------------------
1qhdA1          ----------------------------
1ffhA2          IYFAGLEPFY------------------
1jjvA           AQNLPHLQQKVLELHQFYLQQAENK---
1ckvA           ----------------------------
1rkbA           ----------------------------
1kgdA           ----------------------------
1grqA           ----------------------------
1l7lA           ----------------------------
1jb1A           ----------------------------
1urjA           ----------------------------
1mukA           VMTATG----------------------
1l1oA           ----------------------------
1poiA           ----------------------------
2yyeA2          ----------------------------
1ii8.1          GSSKV-----------------------
1t3wA           ----------------------------
1yvuA2          LYRD----EVAAF---------------
1mjgM           VGLCGAVSWLDAKASYEINHAGPNQP--
2gk3A1          VLPVI-----------------------
1bmfA3          IFLETELFYK------------------
1bgxT2          YLITP--AWLWEKYG-------------
1cr0A           LVL-------------------------
1afrA           MMRKKISMP-------------------
1em8A           FVPHNLAGEGPRGG--------------
1udwA           LVA-------------------------
1f2t.1          ----------------------------
2axpA1          ----------------------------
1tljA           ----------------------------
1tmkA           KGIQEVEALIQIVEPVLSTHIDHDKFS-
1zp6A1          ----------------------------
1viaA           ----------------------------
1vhhA           AVDITTSDRDRSKYGMLARLAVEAGFD-
1qhlA           ----------------------------
1g6oA           ----------------------------
2qgmA1          NPREFLK---------------------
1g8yA           AEEWGVDDDQRRFFVRFGVS--------
2je6I3          ----------------------------
1ni3A1          ----------------------------
1jqjA3          ----------------------------
1e6cA           ----------------------------
1a4iA2          AEEIGIKATHIKLPRTTTESEVMKY---
1xbtA1          ----------------------------
1c4oA1          ----------------------------
1q3tA           ----------------------------
1atrA1          ----------------------------
1es6A2          ----------------------------
1n25A           MKF-------------------------
1o7d.2          FDPNTG----------------------
1jqjA2          ----------------------------
1pgsA2          ----------------------------
1v47A1          RVALLHVAE-------------------
1j1zA2          SPKYAELVYYGFWYAPEREAL-------
2gtlM1          ----------------------------
1vplA           IVETGTVEEL------------------
1cd5A           ----------------------------
2ancF1          ----------------------------
1jbkA           ----------------------------
1bs2A1          VAGQTEELATLALYGAARQVLY------
1gm5A1          ----------------------------
1f8xA           EEDVGLGMELGYALSQGKYVLLVIPDED
1mm8A           WWMRPDDPAD------------------
1lw7A2          ----------------------------
1mi8A           ----------------------------
1ak2A1          ----------------------------
1zbsA1          FDDFLVRNV-------------------
1ohcA1          ----------------------------
1e3mA2          ----------------------------
1uouA3          RLRRGTPWLRVHRDGPALSG--------
1zs3A1          ----------------------------
1s9hA           ----------------------------
1np6A           ----------------------------
1dhyA1          QDPFGLPLEI------------------
1ckeA           SIEQ------------------------
1f46A           ----------------------------
2f9hA1          ----------------------------
1l3aA           ----------------------------
1p5zB           ----------------------------
1esmA           FTDPDSYFH-------------------
1w1wA           ----------------------------
1i1qA           ----------------------------
1ovmA2          ----------------------------
2vnuD1          ----------------------------
2vgmA3          LPD-------------------------
1d8jA           ----------------------------
1g8fA3          ----------------------------
1yr6A1          ----------------------------
1yj5A2          ----------------------------
1odfA           ----------------------------
2pa7A1          KI--------------------------
1g6hA           IIAEGRGEEE------------------
1iioA           ----------------------------
2gujA1          ----------------------------
1lnzA2          ----------------------------
1fl9A           ----------------------------
1ps9A1          ----------------------------
1g31A           SLPVG-----------------------
1tpzA           ----------------------------
1dnpA2          VVCEGFDDSVILPPGAVMTGNHEMY---
1tueA           ----------------------------
1e2hA           ----------------------------
1bifA1          ----------------------------
1gqtA           ----------------------------
1zd9A1          ----------------------------
1mkyA1          ----------------------------
3cddA1          ----------------------------
2cxxA1          ----------------------------
1a2kC           ----------------------------
1dwmA           GVVTSV----------------------
1xzpA1          ----------------------------