[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF66838.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1rrmA.bssp"
#ERROR : Can't open dsspfile "1oj7A.bssp"
#ERROR : Can't open dsspfile "1vljA.bssp"
#ERROR : Can't open dsspfile "1o2dA.bssp"
#ERROR : Can't open dsspfile "1dqsA.bssp"
#ERROR : Can't open dsspfile "1ujnA.bssp"
#ERROR : Can't open dsspfile "1kzhA.bssp"
#ERROR : Can't open dsspfile "1jpuA.bssp"
#ERROR : Can't open dsspfile "1occE.bssp"

## Summary of PDB Search
:370
    8e-78  32%  1rrmA  [e.22.1.2] LACTALDEHYDE REDUCTASE
    4e-69  23%  1oj7A  [e.22.1.2] HYPOTHETICAL OXIDOREDUCTASE YQHD
    9e-63  20%  1vljA  [e.22.1.2] NADH-DEPENDENT BUTANOL DEHYDROGENASE
    1e-61  26%  1o2dA  [e.22.1.2] ALCOHOL DEHYDROGENASE, IRON-CONTAINING
    4e-46  16%  1dqsA  [e.22.1.1] PROTEIN (3-DEHYDROQUINATE SYNTHASE)
    1e-40  17%  1ujnA  [e.22.1.1] DEHYDROQUINATE SYNTHASE
    3e-37  11%  1kzhA  [c.89.1.1] PHOSPHOFRUCTOKINASE
    5e-30  25%  1jpuA  [e.22.1.2] GLYCEROL DEHYDROGENASE
    3e-15   6%  1occE  [a.118.11.1] CYTOCHROME C OXIDASE
:370

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNTFSLQTRLYSGQGSLAVLKRFTNKHIWIICDGFLAHSPLLDTLRNALPADNRISVFSEITPAPTIHTV
1rrmA           -NRXILNETAWFGRGAVGALKRRGYQKALIVTDKTLVQCGVVAKVTDKXDAAGLAWIYDGVVPNPTITVV
1oj7A           LNNFNLHTRILFGKGAIAGLREQIPHDARVLIGGSVKKTGVLDQVLDAL-KGMDVLEFGGIEPNPAYETL
1vljA           NFVFHNPTKIVFGRGTIPEIKNAGIRKVLFLYGGSIKKNGVYDQVVDSLKKHGEWVEVSGVKPNPVLSKV
1o2dA           VWEFYXPTDVFFGEKILEIIDLLGKRALVVTGKSSSKKNGSLDDLKKLLDETESYEIFDEVEENPSFDNV
1dqsA           ---ILGRESIIADFGLWRLISDCSSTTYVLVTDTNIG-SIYTPSFEEAFRKRLLIYNRPPGEVSKSRQTK
1ujnA           MQRLEVRYPILVGEGVLKEVPPLA-GPAALLFDRRVE--GFAQEVAKAL-GVRHLLGLPGGEAAKSLEVY
1kzhA           -----------------------------------------ESLINSYRNTGGFDIVSSGRTKIETEEHY
1jpuA           --VFISPAKYVQGKNVITYLEGI-GNKTVVIADEI-VWKIAGHTIVNELKKGNIAAEEVVFSGEASRNEV
1occE           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VQGIAQMQALQPQVVIGFGGGSAMDAAKAIVWFSQQSGINIETCVAIPTTSGTGSEVTSACVISDPDKGI
1rrmA           KEGLGVFQNSGADYLIAIGGGSPQDTCKAIGIISNNEGLSPTNILAIPTTAGTAAEVTINYVITDEEKRR
1oj7A           MNAVKLVREQKVTFLLAVGGGSVLDGTKFIPWHILQTGGKEIKSGCVLTLPATGSESNAGAVISRKTTGD
1vljA           HEAVEVAKKEKVEAVLGVGGGSVVDSAKAVAAGALYEGDIWDAFFDVLTISATGTEMNGNAVITNEKTKE
1o2dA           XKAVERYRNDSFDFVVGLGGGSPXDFAKAVAVLLKEKDLSVEPVVEIPTTAGTGSEVTPYSILTDPEGNK
1dqsA           ADIEDWMLSQNPPVVIALGGGVIGDLTGFV-ASTYMRGVRY---VQVPTTLLAMVDSSIGGKTAIDTPLG
1ujnA           GKVLSWLAEKGLPRNATLGGGTLTDLG-GFVAATYLRGVAY---LAFPTTTLAIVDASVGGKTGINLPEG
1kzhA           NKALFVAKENNLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVNDHIEISFGFDSATKIYSELIGNLCYW
1jpuA           ERIANIARKAEAAIVIGVGGGKTLDTAKAVADELDAY------IVIVPTAASTDAPTSALSVGVFESYRF
1occE           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KYPLFNNALYPDMAILDPELVVSVPPQITANTGMDVLTHALEAWVSPRASDFTDALAEKAAKLVFQYLPT
1rrmA           KFVCVDPHDIPQVAFIDADXXDGXPPALKAATGVDALTHAIEGYITRGAWALTDALHIKAIEIIAGALRG
1oj7A           KQAFHSAHVQPVFAVLDPVYTYTLPPRQVANGVVDAFVHTVEQYVTPVDAKIHDRFAEGILLTLIEDGPK
1vljA           KYGVSSKALYPKVSIIDPSVQFTLPKEQTVYGAVDAISHILEYYFDGSSPEISNEIAEGTIRTIMKMTER
1o2dA           RGCTLX---FPVYAFLDPRYTYSXSDELTLSTGVDALSHAVEGYLSRKSTPPSDALAIEAXKIIHRNLPK
1dqsA           KN-LIGAIWQPTKIYIDLEFLETLPVREFINGMAEVIKTAAISSEEEFTALEENATILKAVRRRFEGTEE
1ujnA           KNLVGA-FHFPQGVYAELRALKTLPLPTFKEGLVEAFKHGLIAGDEALLTPQSPRLEAFLARAVAVKVRV
1kzhA           HFVKLMGRSASHVALECALKEEVLAKKKTLSEIIDEMVSVILKRSLNGDNFGVVIVPEGL----IEFIPE
1jpuA           Y------KKNPDLVLVDTKIIANAPPRLLASGIADALATWVEARSVIKSGGKTMAIAEKCEQTLFKYGKL
1occE           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AVEKGDCVATRGKMHNASTLAGMAFSQAGLGLNHAIAHQLGGQFHLPHGLANALLLTTVIRFNAGVPXXX
1rrmA           SVAGDKDAGEE--XALGQYVAGXGFSNVGLGLVHGXAHPLGAFYNTPHGVANAILLPHVXRYNA--DFTG
1oj7A           ALKEPENYDVRANVMWAATQALNGLIGAGVPQDHMLGHELTAMHGLDHAQTLAIVLPALWNEKRDTKRAK
1vljA           LIEKPDDYEARANLAWSATIALNGTRRGGEWACHRIEHSLSALYDIAHGAGLAIVFPAWMKYVYRKNPAQ
1o2dA           AIE--GNREARKKXFVASCLAGXVIAQTGTTLAHALGYPLTTEKGIKHGKATGXVLPFVXEVXKEE----
1dqsA           ILKARILASARHKAYVVSADEREGGLRNLLNWGHSIGHAIEAILTPQILHGECVAIGMVKEAE-------
1ujnA           TEEDPLEKGKR----------------RLLNLGHTLGHALEARHALPHGMAVA-----------------
1kzhA           VKSLMLELCDIFDKNEGEFKGLNIEKMKEIFVAKLSDYMKGVYLSLPLFIQFELIKSILERDPHGN----
1jpuA           AYEKAKVVALEAVVEANTLLSGLGFESGGLAAAHAIHNGFGEIHHLTHGEKVAF----------------
1occE           -----------------SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVPEPKIIDAALRACRRL


                         .         *         .         .         .         .         +:350
query           XXXXXXXXXCGFCPAEANDIAAINALIQQIELLKQRCVLPSLAVALKEGRSDFSARIPAMVQAALADVTL
1rrmA           EKYRDIARVXGVKVEGXSLEEARNAAVEAVFALNRDVGIPPHLRDVGVRKED----IPALAQAALDDVCT
1oj7A           LLQYAERV---WNITEGSDDERIDAAIAATRNFFEQLGVPTHLSDYGLDGSS----IPALLKKLEEHMTQ
1vljA           FERFAKKIFGFEGEGEELILKGIEAFKNWLKKVGAPVSLKDAGIPEED--------IDKIVDNVMLLVEK
1o2dA           ------------IPEKVDTVNH--IFGGSLLKFLKELGLY---EKVAVSSEE----LEKWVEKGSRAKHL
1dqsA           ----------------------------------------------------------------------
1ujnA           ----------------------------------------------------------------------
1kzhA           ----------------------------------------------------------------------
1jpuA           ----------GTLVQLALEEHSQQEIERYIELYL-CLDLP---VTLEDKLKDASEDILKVAKAATAEGET
1occE           NDFASAVRILVVKDKAGPHKEIYPYVIQELRPTLNELGISTPE---------------------------


                         .         .         .         .         *         .         .:420
query           RTNPRPANAEAIRxxxxxxx
1rrmA           GGNPREATLEDIV-------
1oj7A           LGENHDITLDVSR-------
1vljA           NLKPKGASLGRIM-------
1o2dA           KNTPGTFTPEKIR-------
1dqsA           --------------------
1ujnA           --------------------
1kzhA           --------------------
1jpuA           IHNAFNVTADDV--------
1occE           --------------------