[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF67239.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1v4aA1.bssp"
#ERROR : Can't open dsspfile "1d5yA2.bssp"
#ERROR : Can't open dsspfile "1bl0A2.bssp"
#ERROR : Can't open dsspfile "1xcbA1.bssp"
#ERROR : Can't open dsspfile "1bl0A1.bssp"

## Summary of PDB Search
:309
    2e-16  12%  1v4aA1 [a.24.16.4] GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE
    1e-12  31%  1d5yA2 [a.4.1.8] ROB TRANSCRIPTION FACTOR A:57 -- 121
    1e-12  25%  1bl0A2 [a.4.1.8] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN)
    3e-05   7%  1xcbA1 [a.4.5.38] REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX A:4
    7e-05  16%  1bl0A1 [a.4.1.8] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN)
:309

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v4aA1          ----------------------------------------------------------------------
1d5yA2          ----------------------------------------------------------------------
1bl0A2          ----------------------------------------------------------------------
1xcbA1          ----------------------------------------------------------------------
1bl0A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v4aA1          ----------------------------------------------------------------------
1d5yA2          ----------------------------------------------------------------------
1bl0A2          ----------------------------------------------------------------------
1xcbA1          ----------------------------------------------------------------------
1bl0A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEIILSSAQITLKER
1v4aA1          --------------------------------------------------------EIEFIVQVFQLIRG
1d5yA2          ----------------------------------------------------------------------
1bl0A2          ----------------------------------------------------------------------
1xcbA1          ------------------------------------------------------------------TYLR
1bl0A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VYNIISSSPSRQWKLTDVADHIFMSTSTLKRKLAEEGTSFSDIYLSARMNQAAKLLRIGNHNVNAVALKC
1v4aA1          GREPSLQSRSLLPTLSAIAELHLLSENDAEQLRVAYFLRRLENLLQSINDEQTQTLPSDELNRARLAWAX
1d5yA2          -----------------------------------------------RLSKSAVALRLTARPILDIALQY
1bl0A2          -----------------------------------------------KMTEIAQKLKESNEPILYLAERY
1xcbA1          ILEELEAQGVHRTSSEQLGELAQVTAFQVRKYFGSYGTRGVGYTVPVLKRELRHIL--------------
1bl0A1          ---------------------------------------------AITIHSILDWIEDNPLSLEKVSERS


                         .         *         .         .         .         .         +:350
query           GYDSTSYFIQCFKKYFKTTPSTFIKxxxx
1v4aA1          DFADWPQLTGALTAHXTNVRRVF------
1d5yA2          RFDSQQTFTRAFKKQFAQTPALYRR----
1bl0A2          GFESQQTLTRTFKNYFDVPPHKYRM----
1xcbA1          -----------------------------
1bl0A1          GY-SKWHLQRMFKKETGHSLGQYIR----