[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF67339.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1f9zA.bssp"
#ERROR : Can't open dsspfile "1sqiA1.bssp"
#ERROR : Can't open dsspfile "1twuA.bssp"
#ERROR : Can't open dsspfile "1r9cA.bssp"
#ERROR : Can't open dsspfile "1kllA.bssp"
#ERROR : Can't open dsspfile "1zswA1.bssp"
#ERROR : Can't open dsspfile "1sp9A.bssp"
#ERROR : Can't open dsspfile "1f1rA1.bssp"
#ERROR : Can't open dsspfile "1u6lA.bssp"
#ERROR : Can't open dsspfile "1bylA.bssp"
#ERROR : Can't open dsspfile "1mpyA1.bssp"
#ERROR : Can't open dsspfile "2pjsA1.bssp"
#ERROR : Can't open dsspfile "1cjxA1.bssp"
#ERROR : Can't open dsspfile "1cjxA2.bssp"
#ERROR : Can't open dsspfile "1bh5A.bssp"
#ERROR : Can't open dsspfile "1dhyA2.bssp"
#ERROR : Can't open dsspfile "1jc4A.bssp"
#ERROR : Can't open dsspfile "1ss4A.bssp"
#ERROR : Can't open dsspfile "1xqaA.bssp"
#ERROR : Can't open dsspfile "1tsjA.bssp"
#ERROR : Can't open dsspfile "1lqkA.bssp"
#ERROR : Can't open dsspfile "1ecsA.bssp"
#ERROR : Can't open dsspfile "1f1rA2.bssp"
#ERROR : Can't open dsspfile "1sp8A1.bssp"
#ERROR : Can't open dsspfile "1mpyA2.bssp"
#ERROR : Can't open dsspfile "2i7rA1.bssp"
#ERROR : Can't open dsspfile "1zswA2.bssp"

## Summary of PDB Search
:135
    5e-30  90%  1f9zA  [d.32.1.1] GLYOXALASE I
    3e-28  19%  1sqiA1 [d.32.1.3] 4-HYDROXYPHENYLPYRUVIC ACID DIOXYGENASE A:8 --
    2e-25  14%  1twuA  [d.32.1.8] HYPOTHETICAL PROTEIN YYCE
    5e-25  16%  1r9cA  [d.32.1.2] GLUTATHIONE TRANSFERASE
    6e-25  18%  1kllA  [d.32.1.2] MITOMYCIN-BINDING PROTEIN
    1e-24  14%  1zswA1 [d.32.1.10] GLYOXALASE FAMILY PROTEIN A:1 -- 144
    9e-24  14%  1sp9A  [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE
    3e-23  22%  1f1rA1 [d.32.1.3] HOMOPROTOCATECHUATE 2,3-DIOXYGENASE A:3 -- 147
    3e-23  14%  1u6lA  [d.32.1.7] HYPOTHETICAL PROTEIN
    4e-23  16%  1bylA  [d.32.1.2] PROTEIN (BLEOMYCIN RESISTANCE PROTEIN)
    2e-22  18%  1mpyA1 [d.32.1.3] CATECHOL 2,3-DIOXYGENASE A:1 -- 145
    2e-22  19%  2pjsA1 [d.32.1.2] UNCHARACTERIZED PROTEIN ATU1953 A:3 -- 113
    5e-22  11%  1cjxA1 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:4 -- 153
    1e-21  12%  1cjxA2 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:154 -- 356
    2e-21  38%  1bh5A  [d.32.1.1] LACTOYLGLUTATHIONE LYASE
    3e-21  18%  1dhyA2 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:133 --
    4e-21  19%  1jc4A  [d.32.1.4] METHYLMALONYL-COA EPIMERASE
    9e-21  19%  1ss4A  [d.32.1.6] GLYOXALASE FAMILY PROTEIN
    1e-20  19%  1xqaA  [d.32.1.2] GLYOXALASE/BLEOMYCIN RESISTANCE PROTEIN
    1e-19  10%  1tsjA  [d.32.1.7] CONSERVED HYPOTHETICAL PROTEIN
    2e-17  28%  1lqkA  [d.32.1.2] PROBABLE FOSFOMYCIN RESISTANCE PROTEIN
    9e-16  21%  1ecsA  [d.32.1.2] BLEOMYCIN RESISTANCE PROTEIN
    3e-15  16%  1f1rA2 [d.32.1.3] HOMOPROTOCATECHUATE 2,3-DIOXYGENASE A:148 -- 323
    9e-14  23%  1sp8A1 [d.32.1.3] 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE A:36 -- 207
    2e-07  19%  1mpyA2 [d.32.1.3] CATECHOL 2,3-DIOXYGENASE A:146 -- 307
    1e-04  17%  2i7rA1 [d.32.1.2] CONSERVED DOMAIN PROTEIN A:1 -- 115
    2e-04  20%  1zswA2 [d.32.1.10] GLYOXALASE FAMILY PROTEIN A:145 -- 314
:135

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRLLHTMLRVGDLQRSIAFYTNVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVESYDMGN
1f9zA           MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGT
1sqiA1          LHFHSVTFWVGNAKQAASFYCNKMGFEPLAYKGLETSREVVSHVIKQGKIVFVLCSALNPWNKEMGDHGD
1twuA           AAQIRIARPTGQLDEIIRFYEEGLCLKRIGEFSQHNGYDGVMFGLPHADYHLEFTQYEGGSTAPVPHPDS
1r9cA           EGLSHMTFIVRDLERMTRILEGVFDAREVYASDTEQFSLSREKFFLIGD-----IWVAIMQGEKLAERSY
1kllA           -RISLFAVVVEDXAKSXEFYRKXGVEIPAEADSAPHTEAVLDGGIRLWDTVETVRSYDPEWQAPTGGHRF
1zswA1          KGHHHISMVTKNANENNHFYKNVLGLRRVKMTVNQDDPSMYHLFYGDKTGSPGTSFFEIPLVGRTYRGTN
1sp9A           RRLDHAVGNVPELGPALTYVAGFTGFHQFASGLNSA-----VLASNDEMVLLPINEPVHGTKRKSHNEGA
1f1rA1          VRCAYMEIVVTDLAKSREFYVDVLGLHVTEEDENT------IYLRSLEEFIHHNLVLRQGPIAA----VA
1u6lA           LQIVPYLIFNGNCREAFSCYHQHLGGTLEAXLPFGDSPEPADWKDKILVVGSFALXASDNHPAYPYEGIK
1bylA           LTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDF------AGVVRDDVTLFISAVQDQVVPDNTLAWVW
1mpyA1          MRPGHVQLRVLDMSKALEHYVELLGLIEMDRDDQGRV-----YLKAWTEVDKFSLVLREADE----PGMD
2pjsA1          VRRVVANIATPEPARAQAFYGDILGXP-----VAXDHGWIVTHASPLE-------AHAQVSFAREGGSGT
1cjxA1          MGFEFIEFASPTPGTLEPIFEIMGFTKVATHRSKNV-----HLYRQGEINLILNNEPNSIASYFAAEHGP
1cjxA2          KVIDHLNVYRGRMVYWANFYEKLFNFREARYFDIKGEYTGLTSKAMSAPDGMIRIPLGQIEEFLMQFNGE
1bh5A           FLLQETMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEALSRKATLELTHNWGTEDDETPR
1dhyA2          QGIGHFVRCVPDTAKAMAFYTEVLGFVLSDIIDIVPAHF------LHCNGRHHTIALAAFPI---PKRIH
1jc4A           ICIDHVAYACPDADEASKYYQETFGWHELHREENPEQGVVEIXXAPAAKLTEHXTQVTVAKWLAKHNGRA
1ss4A           LRXDNVSIVVESLDNAISFFEEIGLNLEGR--ANVEGEWAGRVTGLGSQCVEIAIELSRFLTPPTPVNAL
1xqaA           -GIKHLNLTVADVVAAREFLEKYFGLTCSGTRGNA------FAVXRDNDGFILTLXKGKEVQ---YPKTF
1tsjA           -KITTFLXFNNQAEEAVKLYTSLFEDSEIITXAKYGDPGT------------VQHSIFTLNGQVFXAIDP
1lqkA           TGLNHLTLAVADLPASIAFYRDLLGFRLEARWDQG------AYLELGSLWLCLSREPQYGGP------AA
1ecsA           ----TPNLPSRDFDSTAAFYE-RLGFGIVFRDAG------WMILQRGDLM-------LEFFAHPGLDPLA
1f1rA2          VRLDHFNQVTPDVPRGRAYLEDLGFRVSEDIKDS-DGVTYAAWMHRKQTVHDTALTGGNGPR------MH
1sp8A1          LAFHHVELWCADAASAAGRFSFGLGAPLAARSDLSTRSGSLSFLFYAHGADAATAALPSFSAAAAADHGL
1mpyA2          -RFDHALMYGDELPATYDLFTKVLGFYLAEQVLDENGTRVAQFLSLSTKAHDVAF-------IHHPEKGR
2i7rA1          ---------VSNVPQVCADLEHILDKKADYANDG--------FAQFTIGSHCLXLSQNHLVPLENFQSGI
1zswA2          -------LTVRRLDKMASTLTEIFGYTEVSRNDQ----EAIFQSIKGEAFGEIVVKYL---DGPTEKPG-


                         .         .         *         .         .         .         .:140
query           AYGHIALSVDNAAEACERIRQNGGNVTREAGPVKGGSTIIAFVEDPDGYKIELIEAKDAxxxxxx
1f9zA           AYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIEEGN-------
1sqiA1          GVKDIAFEVEDCEHIVQKARERGAKIVREPWVEKFGKVKFAVLQTYGDTTHTLVEKIN-------
1twuA           LLVFYVPNAVELAAITSKLKHMGYQEVESENPYWSNGG--VTIEDPDGWRIVFMNSKGI------
1r9cA           NHIAFKIDDADFDRYAERVGKLGLDMRPPRP------GRSIYFYDDDNHMFELHT----------
1kllA           AIAFEFPDTASVDKKYAELVDAGYEGHLKPWNAVWGQR-YAIVKDPDGNVVDLFA----------
1zswA1          AITRIGLLVPSEDSLHYWKERFEKFDVKHSEMTTYANRPALQFEDAEGLRLVLLVSNG-------
1sp9A           GLQHLALMSEDIFRTLREMRKRSSIGGFDFMPSPPPTYYNLKKRVGDVLSDDQIKECEE------
1f1rA1          AFAYRVKSPAEVDAAEAYYKELGCRTERRKEGFTKGIGDSVRVEDPLGFPYEFFYETE-------
1u6lA           GCSSLNVDSKAEAERLFNALAEGGSVQXPLGPTFWAASFGXF-TDRFGVAWXVNCEQD-------
1bylA           VRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGRE--FALRDPAGNCVHFVA----------
1mpyA1          FMGFKVVDEDALRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHHFELYADKE-------
2pjsA1          DVPDLSIEVDNFDEVHARILKAGLPIEYGPVTEAWGVQ-RLFLRDPFGKLINIL-----------
1cjxA1          SVCGMAFRVKDSQKAYNRALELG--AQPIHIDTGPMELNLPAIKGIGGAPLYLIDRFGE------
1cjxA2          GIQHVAFLTDDLVKTWDALKKIGMRFMTAPPDTYYE-MLEGRLPDHGEPVDQLQARGI-------
1bh5A           GFGHIGIAVPDVYSACKRFEELGVKFVK--KPDDGKMKGLAFIQDPDGYWIQILNPNKM------
1dhyA2          HFMLQANTIDDVGYAFDRLDAAGRITSLL-GRHTNDQTLSFYADTPSPMIEVEFGWGP-------
1jc4A           GLHHXAWRVDDIDAVSATLRERGVQLLYDEPKLGTGGNRINFPKSGKGVLIELTQYP--------
1ss4A           GYLRVXFTVEDIDEXVSRLTKHGAELVGEVVQYENSYR-LCYIRGVEGILIGLAEEL--------
1xqaA           HVGFPQESEEQVDKINQRLKEDGFLVEPPKHAAY-----TFYVEAPGGFTIEV------------
1tsjA           ISLFVTVKDTIEXERLFNGLKDEGAILXPKTNXPPYRE-FAWVQDKFGVSFQLAL----------
1lqkA           DYTHYAFGIAAADFARFAAQLRAHGVREWKQNRSEGDSF--YFLDPDGHRLEA------------
1ecsA           SWFSCCLRLDDLAEFYRQCKSVGIQETSSGYPRIHAPETMAALVDPDGTLLRLIQNE--------
1f1rA2          HVAFATHEKHNIIQICDKMGALRISDRIERGPGRHGVSFYLYILDPDGHRIEIY-----------
1sp8A1          AVRAVALRVADAEDAFRASVAAGARPAFGPVDLGRGDVVLRYVSYPDG-----------------
1mpyA2          LH-HVSFHLETWEDAADLISMTDTSI--DIGPTRHGLTHGKTFFDPSGNRNEV------------
2i7rA1          I---IHIEVEDVDQNYKRLNELGIKVLHGPTVTDWG-TESLLVQGPAGLVLDFYRXK--------
1zswA2          -RGHLAIRVKNLAYWEEQVKQRGFHSS---GIIDRFYFKSLYFRESNGILFEI------------