[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF67354.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1zkiA1.bssp"
#ERROR : Can't open dsspfile "1o0iA.bssp"
#ERROR : Can't open dsspfile "1q4sA.bssp"
#ERROR : Can't open dsspfile "1yocA1.bssp"
#ERROR : Can't open dsspfile "2cy9A1.bssp"
#ERROR : Can't open dsspfile "1j1yA.bssp"
#ERROR : Can't open dsspfile "1sh8A.bssp"
#ERROR : Can't open dsspfile "2ov9A1.bssp"
#ERROR : Can't open dsspfile "2nujA1.bssp"
#ERROR : Can't open dsspfile "1vpmA.bssp"
#ERROR : Can't open dsspfile "2av9A1.bssp"
#ERROR : Can't open dsspfile "2ownA2.bssp"

## Summary of PDB Search
:137
    5e-18  23%  1zkiA1 [d.38.1.5] HYPOTHETICAL PROTEIN PA5202 A:4 -- 129
    7e-16  42%  1o0iA  [d.38.1.5] HYPOTHETICAL PROTEIN HI1161
    6e-12  21%  1q4sA  [d.38.1.5] THIOESTERASE
    5e-11   6%  1yocA1 [d.38.1.5] HYPOTHETICAL PROTEIN PA1835 A:1 -- 145
    3e-10  13%  2cy9A1 [d.38.1.5] THIOESTERASE SUPERFAMILY MEMBER 2 A:13 -- 139
    6e-08  14%  1j1yA  [d.38.1.5] PAAI PROTEIN
    6e-08  14%  1sh8A  [d.38.1.5] HYPOTHETICAL PROTEIN PA5026
    7e-07   8%  2ov9A1 [d.38.1.5] HYPOTHETICAL PROTEIN A:7 -- 209
    4e-05   9%  2nujA1 [d.38.1.1] THIOESTERASE SUPERFAMILY A:3 -- 161
    6e-05   9%  1vpmA  [d.38.1.1] ACYL-COA HYDROLASE
    9e-05  11%  2av9A1 [d.38.1.1] THIOESTERASE A:5 -- 146
    3e-04  11%  2ownA2 [d.38.1.8] PUTATIVE OLEOYL-[ACYL-CARRIER PROTEIN] A:150 --
:137

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIWKRHLTLDELNATSQNTLVAHLGIVYTRLGDDVLEAEMPVDARTHQPFXXXXXXXXXXXXETLGSMAG
1zkiA1          ----------------------LVGLDPVSLGDGVAEVRLPXAAHLRNRGGVXHGGALFSLXDVTXGLAC
1o0iA           -LWKKTFTLENLNQLCSNSAVSHLGIEISAFGEDWIEATXPVDHRTXQPFGVLHGGVSVALAETIGSLAG
1q4sA           ------DVASHYPVAYEQTLDGTVGFVIDEMTPERATASVEVTDTLRQRWGLVHGGAYCALAEMLATEAT
1yocA1          ------VGPAQFSAMQFAPYFASIAPQFVELRPGYAEVTFPKRREVLNHIGTVHAIALCNAAELAAGTMT
2cy9A1          ---------------KVPGFDVLEKVTLVSAAPEKLICEXKVEEQHTNKLGTLHGGLTATLVDSISTXAL
1j1yA           -----------------DPFMEALGLKVLHLAPGEAVVAGEVRADHLNLHGTAHGGFLYALADS----AF
1sh8A           ----MPLPTELARHLTEEAFVQRSGLRAEVLEPGYVRLRMPGAGNE-NHIGSMYAGALFTLAELPGGALF
2ov9A1          --------VTRHDPVTGPENALAPPVVLEGLSDGSVRGTVTLTIPYQGPPGHVHGGVSALLLDHVLGVAN
2nujA1          ------------------PLPAETLRALSIPAPWTFGLADRVDAIGHVNHTAYLRWYESFRLPFLKARHV
1vpmA           ---------------------------SYPVERSRTIQTRLVLPPDTNHLGTIFGGKVLAYIDEIAALTA
2av9A1          ----------------------------PLREQYLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYG
2ownA2          -------------------------PISFEATDTTITKPYHVRFFDIDPNRHVNNAHYFDWLVDTLPATF


                         .         .         *         .         .         .         .:140
query           YLMTRDGQCVVGTELNATHHRAVSQGKVRGVCLPLHLGRQNQSWEITLFDEQGRRCCTCRLGTAVMG
1zkiA1          SSSHGFDRQSVTLECKINYIRAVADGEVRCVARVLHAGRRSLVVEAEVRQG-DKLVAKGQ-------
1o0iA           SLCLEEGKTVVGLDINANHLRPVRSGKVTARATPINLGRNIQVWQIDIRTEENKLCCVSRL------
1q4sA           VAVVHKGMMAVGQSNHTSFFRPVKEGHVRAEAVRIHAGSTTWFWDVSLRDDAGRLCAVSSM------
1yocA1          DASIPAGHRWIPRGMTVEYLAKATGDRAVADGSQIDWQATGNLVPVVAYVD-DKPVFRAEITMYVS-
2cy9A1          -----XCTPGVSVDXNITYXSPAKIGEIVITAHILKQGKTLAFASVDLTKTTGKLIAQGR-HTKHLG
1j1yA           ALASNTRGPAVALSCRMDYFRPLGAGRVEARAVEVNLSRRTATYRVEVVSE-GKLVALFTG------
1sh8A           LTSFDSARYPIVKEMTLRFRRPAKGDIRQLETEAGERGKAEYSLELQLTDEQGEVVAESAALYQLR-
2ov9A1          AWGGK---AGXTAQLSTRYHRPTPLFPLTLTGKLXSVDGRKITTAGDIRTADGQVCVSVEG------
2nujA1          TDYGPTSPRLVLKQVHCTYLAEXGXGDYVITGRVSNFRTTSFTXEFACWGDAVECTSEGSAVVVLL-
1vpmA           XKHAN-SAVVTASIDSVDFKSSATVGDLELEGFVTHTGRTSXEVYVRVHSNNGERTLTTE-------
2av9A1          LDIQGGEVIGLVVSSSCDYFAPVAFPQIEXGLRVARLGNSSVQYELALFLEGQREACAAGRFVHVF-
2ownA2          LLQ------HDLVHVDVRYENEVKYGQVTAHANILPSEVADQVTTSHLIEVDDEKCCEVTIQWRTL-