[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF67435.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ixcA2.bssp"
#ERROR : Can't open dsspfile "1al3A.bssp"
#ERROR : Can't open dsspfile "2esnA2.bssp"
#ERROR : Can't open dsspfile "1ylnA2.bssp"
#ERROR : Can't open dsspfile "1b9mA1.bssp"
#ERROR : Can't open dsspfile "1bcpF.bssp"
#ERROR : Can't open dsspfile "1fokA2.bssp"
#ERROR : Can't open dsspfile "2p4wA1.bssp"
#ERROR : Can't open dsspfile "1utbA.bssp"
#ERROR : Can't open dsspfile "1cy0A.bssp"
#ERROR : Can't open dsspfile "2f2eA1.bssp"
#ERROR : Can't open dsspfile "1r71A.bssp"
#ERROR : Can't open dsspfile "1tg7A1.bssp"
#ERROR : Can't open dsspfile "1tbxA.bssp"
#ERROR : Can't open dsspfile "1r7jA.bssp"
#ERROR : Can't open dsspfile "1okrA.bssp"
#ERROR : Can't open dsspfile "2hr3A1.bssp"
#ERROR : Can't open dsspfile "2fxaA1.bssp"
#ERROR : Can't open dsspfile "2fbhA1.bssp"
#ERROR : Can't open dsspfile "2esnA1.bssp"
#ERROR : Can't open dsspfile "1xmaA.bssp"
#ERROR : Can't open dsspfile "1tqiA1.bssp"
#ERROR : Can't open dsspfile "1xn7A.bssp"
#ERROR : Can't open dsspfile "1lj9A.bssp"
#ERROR : Can't open dsspfile "1lnwA.bssp"
#ERROR : Can't open dsspfile "1rzsA.bssp"
#ERROR : Can't open dsspfile "1p4xA1.bssp"
#ERROR : Can't open dsspfile "3ctaA1.bssp"
#ERROR : Can't open dsspfile "1ixcA1.bssp"
#ERROR : Can't open dsspfile "1r1tA.bssp"
#ERROR : Can't open dsspfile "1jgsA.bssp"
#ERROR : Can't open dsspfile "1sfxA.bssp"
#ERROR : Can't open dsspfile "2eshA1.bssp"
#ERROR : Can't open dsspfile "2obpA1.bssp"
#ERROR : Can't open dsspfile "1fzpB.bssp"
#ERROR : Can't open dsspfile "1ub9A.bssp"
#ERROR : Can't open dsspfile "1i69A.bssp"
#ERROR : Can't open dsspfile "1p4xA2.bssp"
#ERROR : Can't open dsspfile "1z91A1.bssp"
#ERROR : Can't open dsspfile "1y0uA.bssp"
#ERROR : Can't open dsspfile "1r1uA.bssp"
#ERROR : Can't open dsspfile "1s3jA.bssp"
#ERROR : Can't open dsspfile "1u2wA1.bssp"
#ERROR : Can't open dsspfile "1xmkA1.bssp"
#ERROR : Can't open dsspfile "2fswA1.bssp"
#ERROR : Can't open dsspfile "1biaA1.bssp"
#ERROR : Can't open dsspfile "2p8tA1.bssp"
#ERROR : Can't open dsspfile "1o63A.bssp"
#ERROR : Can't open dsspfile "1ohfA.bssp"
#ERROR : Can't open dsspfile "1wi9A.bssp"
#ERROR : Can't open dsspfile "1jqdA.bssp"

## Summary of PDB Search
:302
    7e-24  13%  1ixcA2 [c.94.1.1] LYSR-TYPE REGULATORY PROTEIN A:90 -- 294
    2e-22  16%  1al3A  [c.94.1.1] CYS REGULON TRANSCRIPTIONAL ACTIVATOR CYSB
    1e-21  13%  2esnA2 [c.94.1.1] PROBABLE TRANSCRIPTIONAL REGULATOR A:92 -- 303
    2e-20  12%  1ylnA2 [b.45.2.2] HYPOTHETICAL PROTEIN VCA0042 A:23 -- 137
    2e-20  14%  1b9mA1 [a.4.5.8] PROTEIN (MODE) A:-1 -- 126
    2e-20  11%  1bcpF  [b.40.2.1] PERTUSSIS TOXIN
    1e-19   9%  1fokA2 [a.4.5.12] PROTEIN (FOKI RESTRICTION ENDONUCLEAS) A:144 --
    2e-19  12%  2p4wA1 [a.4.5.64] TRANSCRIPTIONAL REGULATORY PROTEIN ARSR FAMILY
    6e-18  16%  1utbA  [c.94.1.1] LYSR-TYPE REGULATORY PROTEIN
    3e-17  15%  1cy0A  [e.10.1.1] DNA TOPOISOMERASE I
    2e-16  12%  2f2eA1 [a.4.5.69] PA1607 A:5 -- 146
    3e-15  13%  1r71A  [a.4.14.1] TRANSCRIPTIONAL REPRESSOR PROTEIN KORB
    1e-14  19%  1tg7A1 [b.149.1.1] BETA-GALACTOSIDASE A:570 -- 666
    1e-14   8%  1tbxA  [a.4.5.48] HYPOTHETICAL 11.0 KDA PROTEIN
    1e-14  11%  1r7jA  [a.4.5.49] CONSERVED HYPOTHETICAL PROTEIN SSO10A
    2e-14   8%  1okrA  [a.4.5.39] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
    2e-14  11%  2hr3A1 [a.4.5.28] PROBABLE TRANSCRIPTIONAL REGULATOR A:2 -- 146
    2e-13  14%  2fxaA1 [a.4.5.28] PROTEASE PRODUCTION REGULATORY PROTEIN HPR A:6 --
    4e-13  10%  2fbhA1 [a.4.5.28] TRANSCRIPTIONAL REGULATOR PA3341 A:8 -- 144
    8e-13  20%  2esnA1 [a.4.5.37] PROBABLE TRANSCRIPTIONAL REGULATOR A:3 -- 91
    1e-12  17%  1xmaA  [a.4.5.61] PREDICTED TRANSCRIPTIONAL REGULATOR
    2e-12  10%  1tqiA1 [a.4.5.56] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 90
    5e-12  12%  1xn7A  [a.4.5.62] HYPOTHETICAL PROTEIN YHGG
    1e-11  15%  1lj9A  [a.4.5.28] TRANSCRIPTIONAL REGULATOR SLYA
    1e-11  19%  1lnwA  [a.4.5.28] MULTIDRUG RESISTANCE OPERON REPRESSOR
    2e-11  14%  1rzsA  [a.35.1.2] REGULATORY PROTEIN CRO
    2e-11  11%  1p4xA1 [a.4.5.28] STAPHYLOCOCCAL ACCESSORY REGULATOR A HOMOLOGUE
    2e-11  13%  3ctaA1 [a.4.5.28] RIBOFLAVIN KINASE A:5 -- 89
    3e-11  34%  1ixcA1 [a.4.5.37] LYSR-TYPE REGULATORY PROTEIN A:1 -- 89
    1e-10  13%  1r1tA  [a.4.5.5] TRANSCRIPTIONAL REPRESSOR SMTB
    1e-10  15%  1jgsA  [a.4.5.28] MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN MARR
    3e-10  20%  1sfxA  [a.4.5.50] CONSERVED HYPOTHETICAL PROTEIN AF2008
    3e-10  14%  2eshA1 [a.4.5.61] CONSERVED HYPOTHETICAL PROTEIN TM0937 A:4 --
    5e-10  14%  2obpA1 [a.4.5.71] PUTATIVE DNA-BINDING PROTEIN A:12 -- 92
    6e-10  13%  1fzpB  [a.4.5.28] STAPHYLOCOCCAL ACCESSORY REGULATOR A
    6e-10  27%  1ub9A  [a.4.5.28] HYPOTHETICAL PROTEIN PH1061
    4e-09  14%  1i69A  [c.94.1.1] HYDROGEN PEROXIDE-INDUCIBLE GENES ACTIVATOR
    6e-09  16%  1p4xA2 [a.4.5.28] STAPHYLOCOCCAL ACCESSORY REGULATOR A HOMOLOGUE
    2e-08  12%  1z91A1 [a.4.5.28] ORGANIC HYDROPEROXIDE RESISTANCE TRANSCRIPTIONAL
    4e-08  19%  1y0uA  [a.4.5.5] ARSENICAL RESISTANCE OPERON REPRESSOR, PUTATIVE
    6e-08  10%  1r1uA  [a.4.5.5] REPRESSOR PROTEIN
    7e-08  24%  1s3jA  [a.4.5.28] YUSO PROTEIN
    1e-07  11%  1u2wA1 [a.4.5.5] CADMIUM EFFLUX SYSTEM ACCESSORY PROTEIN A:12 --
    4e-07  19%  1xmkA1 [a.4.5.19] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE
    2e-06  10%  2fswA1 [a.4.5.69] PG_0823 PROTEIN A:3 -- 104
    2e-06  22%  1biaA1 [a.4.5.1] BIRA BIFUNCTIONAL PROTEIN A:1 -- 63
    1e-04  20%  2p8tA1 [a.4.5.72] HYPOTHETICAL PROTEIN PH0730 A:14 -- 82
    1e-04  19%  1o63A  [c.94.1.1] ATP PHOSPHORIBOSYLTRANSFERASE
    3e-04   9%  1ohfA  [b.121.4.8] NUDAURELIA CAPENSIS OMEGA VIRUS CAPSID PROTEIN
    7e-04  14%  1wi9A  [a.4.5.47] PROTEIN C20ORF116 HOMOLOG
    9e-04  19%  1jqdA  [c.66.1.19] HISTAMINE N-METHYLTRANSFERASE
:302

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQLNMLEAMNIYVNVVEQGSFIRAAEVLELHRPAVTRAVQNLEHDLGVKLLHRTTRQVSMTDEGEEFYQR
1ixcA2          ----------------------------------------------------------------------
1al3A           ----------------------------------------------------------------------
2esnA2          ----------------------------------------------------------------------
1ylnA2          ----------------------------------------------------------------------
1b9mA1          LKLQQKLFADPLKHIALSGSISQGAKDAGISYKSAWDAINEXNQLSEHILVERATGGAVLTRYGQRLIQL
1bcpF           ----------------------------------------------------------------------
1fokA2          -------AIEKEILIEAISSYPPAIRILTLLEDGTKFDLGKNLGFSGESGFTSLPEGILLDTLANAMPKD
2p4wA1          -----ETRRRILFLLTKRPFVSELSRELGVGQKAVLEHLRILEEAGLIESRVEKIRKYYMIKKGLRLEIL
1utbA           ----------------------------------------------------------------------
1cy0A           VELTPAQHFTKPPARFSEASLVKELEKRGIGRPSTYA--SIISTIQDRGYVRVENRRFYAEKMGEIVTDR
2f2eA1          ----------VRDAFEGLTRFGEFQKSLGLAKNILAARLRNLVEHGVXVAVPAESGSHRLTDKGRALFPL
1r71A           NELTREIADFIGRELAKGKKKGDIAKEIGKSPAFITQHVTLLDLPEKIADAFNTGRVRDVTVVNELVTAF
1tg7A1          ----------------------------------------------------------------------
1tbxA           -EAIVLAYLYDNEGIATYDLYKKVNAEFPXSTATFYDAKKFLQEGFVKERQERGEKRLYLTEKGKLFAIS
1r7jA           -----KSKLEIIQAILEACKS-GSPKTRIMYGANLSYALRYIKMLMDLEIIRQEGKQYMLTKKGEELLED
1okrA           -EWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKIDRKKDNKIFQYYSLVEESDIKYKT
2hr3A1          VQFSQLVVLGAIDRLGGDVTPSELAAAERXRSSNLAALLRELERGGLIV--RHARTRVSLSSEGRRNLYG
2fxaA1          -----INEHHILWIAYQLNSISEIAKFGVXHVSTAFNFSKKLEERGYLR--FSKRTYVQLTEEGTEVFWS
2fbhA1          -----WLVLLHLARHRDSPTQRELAQSVGVEGPTLARLLDGLESQGLVRRLDRRAKHIVLTPKADVLIAD
2esnA1          ----------VFDALYRHRNVGTAASELAISASAFSHALGRLRQGLDDELFLRQGNRMQPTQRAE-----
1xmaA           --LSLLIEGDSYGYEISKNIRIKTDELYVIKETTLYSAFARLEKNGYIKSYYKRRTYYRITPEGIKYYKQ
1tqiA1          -SWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSL
1xn7A           -----LIQVRDLLALRGRMEAAQISQTLNTPQPMINAMLQQL-ESMGKAVRIQEEPDGCLSGSCKSCP-E
1lj9A           -----RGQYLYLVRVCENPIQEKIAELIKVDRTTAARAIKRLEEQGFIYRSNKKIKRIYATEKGKNVYPI
1lnwA           -----PPDVHVLKLIDEQRNLQDLGRQXCRDKALITRKIRELEGRNLVRRERQRSFQLFLTDEGLAIHQH
1rzsA           --------MYKKDVIDHFGTQRAVAKALGISDAAVSQWKEVIPEKDAYRLEIVTAGALKYQENAYR----
1p4xA1          --------FILLTYLFHQQPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVDERNTYISISEEQREKIAE
3ctaA1          --------------NRAYLTSSKLADMLGISQQSASRIIIDLEKNGYIRTVTKRGQILNITEKGLDVLYT
1ixcA1          -----FRQLKYFIAVAEAGNXAAAAKRLHVSQPPITRQXQALEADLGVVLLE-----IELTAAGHAFLED
1r1tA           -------------------CVGDLAQAIGVSESAVSHQLRSLRNL-RLVSYRKQGRHVYYQLQDHHIVAL
1jgsA           -----AAQFKVLCSIRCAATPVELKKVLSVDLGALTRMLDRLVCKGWVERLPKRGVLVKLTTGGAAICEQ
1sfxA           ----------IYSLLLERGRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGIYSAEKPEKVLKEF
2eshA1          --------------LAERLAEFGIEIPGIGHMGNIYRVLADLEESEWDTTVSPPRKIYRITPQGKLYLRE
2obpA1          -IVEVLLVLREAGIENGATSLPKIAKRAQLPXSVLRRVLTQLQAAGLADVSVEADGHASLTQEGAALAAQ
1fzpB           ------------------TYISENKEKEYYLKDIVVKAVKILSQEDYFDKKRERTVLILVNAQQRKKIES
1ub9A           -----------FLLPRRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKIADRPRTVVEITDFGMEEAKR
1i69A           ----------------------------------------------------------------------
1p4xA2          -------------------LLKDLIETIHHKYPQTVRALNNLKKQGYLIKERERKILIHMDDAQQDHAEQ
1z91A1          -------------------TVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKDERSVLISLTEDGALLKEK
1y0uA           ----------ILRXLDKGRSEEEIXQTLSLSKKQLDYHLKVLEAGFCI---ERVGERWVVTDAGKI----
1r1uA           -------------------SVGHISHQLNLSQSNVSHQLKLLK-SVHLVKAKRQGQSMIYSLDDIHVATM
1s3jA           ----------VLASLKKHGKVSEIAERXEVKPSAVTLXADRLEQKNLIARTHRRVIDLSLTDEGDIKFEE
1u2wA1          ----------ITYALCQDECVCDIANILGVTIANASHHLRTLYKQ---GVVNFRLALYSLGDEHIRQIMM
1xmkA1          ----------ICDYLFNVSSALNLAKNIGLKARDINAVLIDMERQGDVYRQGTTPPIWHLTDKKRERMQ-
2fswA1          ----------IFQINRRIIRYGELKRIPGISEKXLIDELKFLCGKGLIKPEVPPRVEYSLTPLGEKVLPI
1biaA1          -----PLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLR-DWGVDVFTVPGKGYSLP---------
2p8tA1          ----VEDVLAVIFLLKEPLGRKQISERLELGEGSVRTLLRKLS-----HLDIIRSKGHFLTLKGKEIRDK
1o63A           ----------------------------------------------------------------------
1ohfA           ----------------------------------------------------------------------
1wi9A           ------------------------AFQMGLRTQDAINRIQDLLTETLTGVIDDRGKFIYITPSGPS----
1jqdA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           CLSLLSELDDVRRLFSSTQPPKGRLRLDVPITLARAVIIPALGDFQNRYPDIEIVLGTSDRKIDLIAERV
1ixcA2          ----------------------GELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTKDEQVEGLLAGTI
1al3A           -----------------TWPDKGSLYVATTHTQARYALPGVIKGFIERYPRVSLHQGSPTQIAEAVSKNA
2esnA2          --------------------SQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLERKLSVEALASGRI
1ylnA2          ------STINSTDALAMEHXSELTLSITTPVGTKFVCRTPFIGTHTDKFLLVEMPKISADDLQYFFQEGF
1b9mA1          YDLLAQIQQKAFDVLSDDALPLNSLLAAISRFSLQ-----------------------------------
1bcpF           ---------------------KNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGH---EHDTWF
1fokA2          KGEIRNNWEGSSDKYARIGGWLDKLGLVKQGKKEFIIPTPDNKEFSHAFKITGEGL--------------
2p4wA1          LTPTLFGSEMYEAKGVRKSPYEQAKELIKSQEPIN-VKMRELAEFLHELNEILIETYIENTMRRLAEENR
1utbA           ----------------------RTFNLAMTDIGEMYFMPPLMEALAQRAPHIQISTLRGNLKEDMESGAV
1cy0A           LEENFRELMNYDF----TAQMENSLDQ---VANHEAEWKAVLDHFFSDF---------------------
2f2eA1          LVAIR---QWGEDYFFAPDESHVRLVERDSGQPVPRLQVRAGDGSPLAAEDTRVSR--------------
1r71A           KKRPEEVEAWLDDDTQ--EITRGTVKLLREFL--------------------------------------
1tg7A1          ----------------------------------------------------------------------
1tbxA           LKTAIETYKQIKKRHH------------------------------------------------------
1r7jA           IRKFNEMRKNMDQLKEKIN---------------------------------------------------
1okrA           SKNFINKVYKGFNSLVLNFVEKEDLSQDEIEELRNIL---------------------------------
2hr3A1          NRAKREEWLVRAXHACDESERALLAAAGPLLT--------------------------------------
2fxaA1          LLEEFDPTRNVFKGSQPLYHLFGKFPEVAEXCXIRHIYGDDFXEIFET----------------------
2fbhA1          IEAIAASVRNDVLTGIDESEQALCQQV-------------------------------------------
2esnA1          ----------------------------------------------------------------------
1xmaA           KCEEWELTKKVIN---------------------------------------------------------
1tqiA1          ----------------------------------------------------------------------
1xn7A           GKACLREWWALR----------------------------------------------------------
1lj9A           IVRENQHSNQVAL---QGLSEVEISQLADYLVRMRKNVSEDWEFVK------------------------
1lnwA           AEAIXSRVHD-ELFAPLTPVEQATLVHLLDQCLA------------------------------------
1rzsA           ----------------------------------------------------------------------
1p4xA1          RVTLFDQIIKQFNLADQSE---------------------------------------------------
3ctaA1          EFADLSRILAI-----------------------------------------------------------
1ixcA1          ARRIL-----------------------------------------------------------------
1r1tA           YQNALDHLQE------------------------------------------------------------
1jgsA           CHQLVGQDLHELTKNLTADEVATLEYL-------------------------------------------
1sfxA           KSSILGEIERIEKXFT------------------------------------------------------
2eshA1          ILRSLEDMKR------------------------------------------------------------
2obpA1          LF--------------------------------------------------------------------
1fzpB           LLSRVNKR--------------------------------------------------------------
1ub9A           FLSSLKAVIDGLDL--------------------------------------------------------
1i69A           ------------------ETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLAQTHQLLAQLDSKL
1p4xA2          LLAQVNQLLADKD---------------------------------------------------------
1z91A1          AVDIPGTILGLSKQ--------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1r1uA           LKQAIHHANHPK----------------------------------------------------------
1s3jA           VLAGRKAIXA------------------------------------------------------------
1u2wA1          IALAHKK---------------------------------------------------------------
1xmkA1          ----------------------------------------------------------------------
2fswA1          IDEIAKFG--------------------------------------------------------------
1biaA1          ----------------------------------------------------------------------
2p8tA1          LLS-------------------------------------------------------------------
1o63A           --------------------PKGRLEEKVX-TYLKKTGVIFERESSILREGKDIVCVRPFDVPTYLVHVA
1ohfA           -------------MPEFRSWARGKLDIDQ--DSIGWYFKYLDPAGATESARAVGEYIPDGLVKFVDAEIR
1wi9A           ----------------------------------------------------------------------
1jqdA           ---------------------------------------QILSKVQAQYPGVCINNEVVEPSAEQIAKYK


                         +         .         .         .         .         *         .:210
query           DCVIRLGELNDSSFVARRLGTAAMVTCAAPSYLAKHGTPHSIDELMKSHRAVNFFSNHSLQIMEWKFTVD
1ixcA2          HVGFSRFFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTL--FPRGGRPSFADEVIGL
1al3A           DFAIATEALLYDDLVMLPCYHWNRSIVVTPEHPLATKGSVSIEELAQ-YPLVTYTFGFTGRSELDTAFNR
2esnA2          DFALGYDERLPEGIQAHDWFADRYVVVARRDHPRLAGAPT-----LEGYLAERHAVVTPWNEDSGVIDRL
1ylnA2          WMNIRAISPRGEGALIHFRSQ-LMHILQEPVPMAFLSIPNTMQVS-------------------------
1b9mA1          ----------------------------------------------------------------------
1bcpF           DTMLGFAISAYALKSRIALTVEDSPYGTPGDLLELQICP-------------------------------
1fokA2          ----------------------------------------------------------------------
2p4wA1          QIIEEIFRDIEKILPPGYAR--------------------------------------------------
1utbA           DLALGLLPELQTGFFQRRLFRHRYVCMFRKDHPSAKS-PMSLKQFSELEHVGVVALNTGHGEVDGLLERA
1cy0A           ----------------------------------------------------------------------
2f2eA1          ----------------------------------------------------------------------
1r71A           ----------------------------------------------------------------------
1tg7A1          ------------------------------------------------NSAYNYWVPQV----PTKGTAP
1tbxA           ----------------------------------------------------------------------
1r7jA           ----------------------------------------------------------------------
1okrA           ----------------------------------------------------------------------
2hr3A1          ----------------------------------------------------------------------
2fxaA1          ----------------------------------------------------------------------
2fbhA1          ----------------------------------------------------------------------
2esnA1          ----------------------------------------------------------------------
1xmaA           ----------------------------------------------------------------------
1tqiA1          ----------------------------------------------------------------------
1xn7A           ----------------------------------------------------------------------
1lj9A           ----------------------------------------------------------------------
1lnwA           ----------------------------------------------------------------------
1rzsA           ----------------------------------------------------------------------
1p4xA1          ----------------------------------------------------------------------
3ctaA1          ----------------------------------------------------------------------
1ixcA1          ----------------------------------------------------------------------
1r1tA           ----------------------------------------------------------------------
1jgsA           ----------------------------------------------------------------------
1sfxA           ----------------------------------------------------------------------
2eshA1          ----------------------------------------------------------------------
2obpA1          ----------------------------------------------------------------------
1fzpB           ----------------------------------------------------------------------
1ub9A           ----------------------------------------------------------------------
1i69A           DAVILALVKESEAFIEVPLFDEPMLLAIYEDHPWANREAVPMADL----------AGEKLLMLEDGHSLR
1p4xA2          ----------------------------------------------------------------------
1z91A1          ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1r1uA           ----------------------------------------------------------------------
1s3jA           ----------------------------------------------------------------------
1u2wA1          ----------------------------------------------------------------------
1xmkA1          ----------------------------------------------------------------------
2fswA1          ----------------------------------------------------------------------
1biaA1          ----------------------------------------------------------------------
2p8tA1          ----------------------------------------------------------------------
1o63A           DIGF------------------------------------------------------------------
1ohfA           EIYNLDGAQWSLSIISYPMFRTAYFAVANVDNKEISLDVTNDLIVWLNNLASRDVVDSGQWFTFSDDPTW
1wi9A           ----------------------------------------------------------------------
1jqdA           ELVAKTSNLENVKFAWHKE----TSSEYQSRMLEK-----------------------------------


                         .         .         .         +         .         .         .:280
query           GSIASIKIPSSILVDNSEAFLSCGLAGLGVLHGLRPSLAPFIASGELTEILTDFXXXXXXVSLLYPDRRY
1ixcA2          FKHAGIEPRIARVVEDATAALA--LTXAGAASSIVPASVAAIRWPDIAFARIVGTRVKVPISCIFR-KEK
1al3A           ---AGLTPRIVFTATDADVIKTYVRLGLGVGV-IASMAVDPVSDPDLVKLDANGIFSHSTTKIGFRRSTF
2esnA2          LARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQG-
1ylnA2          ----------------------------------------------------------------------
1b9mA1          ----------------------------------------------------------------------
1bcpF           ----------------------------------------------------------------------
1fokA2          ----------------------------------------------------------------------
2p4wA1          ----------------------------------------------------------------------
1utbA           G----IKRRMRLVVPHFIAIGPILHSTDLIATVPQRFAVRCEVPFGLTTSPHPAKLPDIAINLFWHAKYN
1cy0A           ----------------------------------------------------------------------
2f2eA1          ----------------------------------------------------------------------
1r71A           ----------------------------------------------------------------------
1tg7A1          GYSNQETTASSIIVKAGYLVRSAYLDGNDLHI------QADFNATTPIEVVGAPSG----AKNLVINGKK
1tbxA           ----------------------------------------------------------------------
1r7jA           ----------------------------------------------------------------------
1okrA           ----------------------------------------------------------------------
2hr3A1          ----------------------------------------------------------------------
2fxaA1          ----------------------------------------------------------------------
2fbhA1          ----------------------------------------------------------------------
2esnA1          ----------------------------------------------------------------------
1xmaA           ----------------------------------------------------------------------
1tqiA1          ----------------------------------------------------------------------
1xn7A           ----------------------------------------------------------------------
1lj9A           ----------------------------------------------------------------------
1lnwA           ----------------------------------------------------------------------
1rzsA           ----------------------------------------------------------------------
1p4xA1          ----------------------------------------------------------------------
3ctaA1          ----------------------------------------------------------------------
1ixcA1          ----------------------------------------------------------------------
1r1tA           ----------------------------------------------------------------------
1jgsA           ----------------------------------------------------------------------
1sfxA           ----------------------------------------------------------------------
2eshA1          ----------------------------------------------------------------------
2obpA1          ----------------------------------------------------------------------
1fzpB           ----------------------------------------------------------------------
1ub9A           ----------------------------------------------------------------------
1i69A           DQAMGFCFDTHFRATSLETLRNMVAAGSGI--TLLPALAPERKRDGVVYLPAIKPEPRRTIGLVYRPGSP
1p4xA2          ----------------------------------------------------------------------
1z91A1          ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
1r1uA           ----------------------------------------------------------------------
1s3jA           ----------------------------------------------------------------------
1u2wA1          ----------------------------------------------------------------------
1xmkA1          ----------------------------------------------------------------------
2fswA1          ----------------------------------------------------------------------
1biaA1          ----------------------------------------------------------------------
2p8tA1          ----------------------------------------------------------------------
1o63A           ----------------------------------------------------------------------
1ohfA           FVRIRVLHPTYDLPDPTEGLLRTVSDYRLTYKSICEANMPTLVDQGFWIGGHYAPIATTQNAVEGSGFVH
1wi9A           ----------------------------------------------------------------------
1jqdA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LAPKVRVFIDWLCEVFGPDAHx
1ixcA2          QPPILARFVEHVRRSA------
1al3A           LRSYMYDFIQRFAPHLTRD---
2esnA2          -RDAHAWMIGQLKGL-------
1ylnA2          ----------------------
1b9mA1          ----------------------
1bcpF           ----------------------
1fokA2          ----------------------
2p4wA1          ----------------------
1utbA           RDPGNMWLRQLFVELFS-EAH-
1cy0A           ----------------------
2f2eA1          ----------------------
1r71A           ----------------------
1tg7A1          TQTKVDKNGIWSASVA------
1tbxA           ----------------------
1r7jA           ----------------------
1okrA           ----------------------
2hr3A1          ----------------------
2fxaA1          ----------------------
2fbhA1          ----------------------
2esnA1          ----------------------
1xmaA           ----------------------
1tqiA1          ----------------------
1xn7A           ----------------------
1lj9A           ----------------------
1lnwA           ----------------------
1rzsA           ----------------------
1p4xA1          ----------------------
3ctaA1          ----------------------
1ixcA1          ----------------------
1r1tA           ----------------------
1jgsA           ----------------------
1sfxA           ----------------------
2eshA1          ----------------------
2obpA1          ----------------------
1fzpB           ----------------------
1ub9A           ----------------------
1i69A           LRSRYEQLAE------------
1p4xA2          ----------------------
1z91A1          ----------------------
1y0uA           ----------------------
1r1uA           ----------------------
1s3jA           ----------------------
1u2wA1          ----------------------
1xmkA1          ----------------------
2fswA1          ----------------------
1biaA1          ----------------------
2p8tA1          ----------------------
1o63A           ----------------------
1ohfA           PAAGVTLTW-------------
1wi9A           ----------------------
1jqdA           ----------------------