[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF67448.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2a3lA1.bssp"
#ERROR : Can't open dsspfile "1gkpA1.bssp"
#ERROR : Can't open dsspfile "2bb0A1.bssp"
#ERROR : Can't open dsspfile "2gokA1.bssp"
#ERROR : Can't open dsspfile "1xrfA1.bssp"
#ERROR : Can't open dsspfile "3be7A1.bssp"
#ERROR : Can't open dsspfile "1a4lA.bssp"
#ERROR : Can't open dsspfile "1onwA1.bssp"
#ERROR : Can't open dsspfile "2ftyA1.bssp"
#ERROR : Can't open dsspfile "1ymyA1.bssp"
#ERROR : Can't open dsspfile "1a5kC1.bssp"
#ERROR : Can't open dsspfile "1k6wA1.bssp"
#ERROR : Can't open dsspfile "1m7jA1.bssp"
#ERROR : Can't open dsspfile "1k6wA2.bssp"
#ERROR : Can't open dsspfile "2oofA1.bssp"
#ERROR : Can't open dsspfile "2oodA1.bssp"
#ERROR : Can't open dsspfile "2r8cA1.bssp"
#ERROR : Can't open dsspfile "2pajA2.bssp"
#ERROR : Can't open dsspfile "1gkrA1.bssp"
#ERROR : Can't open dsspfile "2i9uA1.bssp"
#ERROR : Can't open dsspfile "2i9uA2.bssp"
#ERROR : Can't open dsspfile "2qs8A1.bssp"
#ERROR : Can't open dsspfile "1j6pA1.bssp"
#ERROR : Can't open dsspfile "1un7A1.bssp"
#ERROR : Can't open dsspfile "2p9bA1.bssp"
#ERROR : Can't open dsspfile "1dpmA.bssp"
#ERROR : Can't open dsspfile "1j6oA.bssp"
#ERROR : Can't open dsspfile "2icsA1.bssp"
#ERROR : Can't open dsspfile "1xwyA1.bssp"
#ERROR : Can't open dsspfile "2amxA1.bssp"
#ERROR : Can't open dsspfile "1m7jA2.bssp"
#ERROR : Can't open dsspfile "2f6kA1.bssp"
#ERROR : Can't open dsspfile "2r8cA2.bssp"
#ERROR : Can't open dsspfile "1a4lA.bssp"
#ERROR : Can't open dsspfile "2qs8A1.bssp"

## Summary of PDB Search
:566
    3e-17  14%  2a3lA1 [c.1.9.1] AMP DEAMINASE A:212 -- 839
    1e-13  16%  1gkpA1 [b.92.1.3] HYDANTOINASE A:2 -- 54 A:390 -- 459
    3e-13  17%  2bb0A1 [b.92.1.10] IMIDAZOLONEPROPIONASE A:3 -- 73 A:374 -- 415
    4e-13  19%  2gokA1 [b.92.1.10] IMIDAZOLONEPROPIONASE A:17 -- 79 A:381 -- 420
    3e-12  19%  1xrfA1 [b.92.1.3] DIHYDROOROTASE A:1 -- 55 A:366 -- 422
    2e-11  16%  3be7A1 [b.92.1.9] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE A:3 -- 56
    2e-11  13%  1a4lA  [c.1.9.1] ADENOSINE DEAMINASE
    2e-11  10%  1onwA1 [b.92.1.7] ISOASPARTYL DIPEPTIDASE A:1 -- 62 A:347 -- 389
    1e-10  12%  2ftyA1 [b.92.1.3] DIHYDROPYRIMIDINASE A:2 -- 56 A:441 -- 541
    3e-10  14%  1ymyA1 [b.92.1.5] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:1
    5e-10  25%  1a5kC1 [b.92.1.1] UREASE (ALPHA SUBUNIT) C:2 -- 129 C:423 -- 475
    6e-10  12%  1k6wA1 [b.92.1.2] CYTOSINE DEAMINASE A:4 -- 55 A:376 -- 426
    3e-09  38%  1m7jA1 [b.92.1.6] D-AMINOACYLASE A:7 -- 61
    3e-09  12%  1k6wA2 [c.1.9.5] CYTOSINE DEAMINASE A:56 -- 375
    4e-09  14%  2oofA1 [b.92.1.10] 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE A:3 --
    6e-09  14%  2oodA1 [b.92.1.4] BLR3880 PROTEIN A:3 -- 72 A:398 -- 467
    6e-09  18%  2r8cA1 [b.92.1.9] PUTATIVE AMIDOHYDROLASE A:2 -- 57 A:369 -- 414
    2e-08  14%  2pajA2 [c.1.9.9] PUTATIVE CYTOSINE/GUANINE DEAMINASE A:70 -- 405
    9e-08  28%  1gkrA1 [b.92.1.3] NON-ATP DEPENDENT L-SELECTIVE HYDANTOINASE A:1
    2e-07  10%  2i9uA1 [b.92.1.4] CYTOSINE/GUANINE DEAMINASE RELATED PROTEIN A:9 --
    3e-07  12%  2i9uA2 [c.1.9.9] CYTOSINE/GUANINE DEAMINASE RELATED PROTEIN A:67 --
    5e-07  25%  2qs8A1 [b.92.1.9] XAA-PRO DIPEPTIDASE A:7 -- 63 A:374 -- 412
    8e-07  18%  1j6pA1 [b.92.1.4] METAL-DEPENDENT HYDROLASE OF A:-1 -- 49 A:331 --
    3e-06  22%  1un7A1 [b.92.1.5] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE A:3
    4e-06  26%  2p9bA1 [b.92.1.10] POSSIBLE PROLIDASE A:9 -- 70 A:395 -- 450
    1e-05  16%  1dpmA  [c.1.9.3] PHOSPHOTRIESTERASE
    2e-05  18%  1j6oA  [c.1.9.12] TATD-RELATED DEOXYRIBONUCLEASE
    3e-05  26%  2icsA1 [b.92.1.8] ADENINE DEAMINASE A:4 -- 54 A:322 -- 371
    4e-05  18%  1xwyA1 [c.1.9.12] DEOXYRIBONUCLEASE TATD A:1 -- 260
    5e-05  19%  2amxA1 [c.1.9.1] ADENOSINE DEAMINASE A:20 -- 376
    6e-05  24%  1m7jA2 [b.92.1.6] D-AMINOACYLASE A:420 -- 480
    1e-04  13%  2f6kA1 [c.1.9.15] METAL-DEPENDENT HYDROLASE A:2 -- 307
    5e-04  23%  2r8cA2 [c.1.9.18] PUTATIVE AMIDOHYDROLASE A:58 -- 368
    2e-06   7%  1a4lA  [c.1.9.1] ADENOSINE DEAMINASE(query 37->185)
    1e-04  18%  2qs8A1 [b.92.1.9] XAA-PRO DIPEPTIDASE A:7 -- 63 A:374 -- 412(query 496->556)
:566

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDIILHNGNIITLNDAQPQASALAISGSRIVAIGDDTATD
2a3lA1          ----------------------------------------------------------------------
1gkpA1          --------------------------------LLIKNGEIIT--ADSRYKADIYAEGETITRIGQNLEAP
2bb0A1          ----------------------------------------------------------------------
2gokA1          -------------------------------TALWRNAQLATLNPAMDGIGVIAVRNGRIAFAGPESDLP
1xrfA1          -------------------------------KLIVKNGYVIDPSQNLEGEFDILVENGKIKKIDKNIL--
3be7A1          -------------------------------DFLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGKI----
1a4lA           ----------------------------------------------------------------------
1onwA1          -------------------------------FTLLQGAHLYA--PEDRGICDVLVANGKIIAVASNI--P
2ftyA1          -------------------------------DLIIKNGIICT--ASDIYAAEIAVNNGKVQLIAASIDPS
1ymyA1          ---------------------------------ALTQGRIFTGHEFLDDH-AVVIADGLIKSVCPVAELP
1a5kC1          -------------------------------DLVLTNALIVDHWGIVKAD--IGVKDGRIFAIGKAGNPD
1k6wA1          --------------------------------QTIINARLPGEEGLW----QIHLQDGKISAIDAQSGVM
1m7jA1          -------------------------------DYILSGGTVIDGTNAPGRLADVGVRGDRIAAVGDLSA--
1k6wA2          ----------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
2oodA1          ----------------------------------------------------------------------
2r8cA1          --------------------------------FLFRNGALLDPDHPDLQGFEILIEDGFIREVSDKPIK-
2pajA2          ----------------------------------------------------------------------
1gkrA1          -------------------------------DVIVKNCRLVSSDGITE--ADILVKDGKVAAISADTSDV
2i9uA1          ----------------------------------------------------------------------
2i9uA2          ----------------------------------------------------------------------
2qs8A1          -------------------------------KTLIHAGKLIDGKSDQVQSRIIVIDGNIISDIKKGFIS-
1j6pA1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
1dpmA           ----------------------------------------------------------------------
1j6oA           ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
1xwyA1          ----------------------------------------------------------------------
2amxA1          ----------------------------------------------------------------------
1m7jA2          ----------------------------------------------------------------------
2f6kA1          ----------------------------------------------------------------------
2r8cA2          ----------------------------------------------------------------------
1a4lA           ------------------------------------NKPKVELHDGAIKPETILYFGKKRGIALPA----
2qs8A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EWRGDHTRTIDLQGKTVIPGLTDTHIHAIRGGQTWTFETYWYDSPSLKDALDKLRADANRRPHDQWVAVV
2a3lA1          ----------------------------------------------------------------------
1gkpA1          P----GTEVIDATGKYVFPGADLVVYDPQYRGTISVKTQHVNNDYNGFEGFEIDGRPSVVTVRGKVAVRD
2bb0A1          ----------------------------------------------------------------------
2gokA1          DDLSTADETTDCGGRWITLEAGKSADFAIWDIER------------------------------------
1xrfA1          ---VPEAEIIDAKGLIVCPTLKLGSPADITIFDP------------------------------------
3be7A1          --NTKDATVISIPDLILIPQIKEGFDADIVGVIE------------------------------------
1a4lA           ----------------------------------------------------------------------
1onwA1          SDIVPNCTVVDLSGQILCPEILPGNDADLLVM--------------------------------------
2ftyA1          LGS-EVIDAEGAFITPILPGVSDADLVIWYPDDSKKEYNSKPKLITNKLMEHNCDYTPFEGIEIKNWPRY
1ymyA1          PE----IEQRSLNGAILSPTLAAGKVANLTAF-----TPDFKITKTIVNGN-------------------
1a5kC1          IQIGAATEVIAAEGKIVTAGSIEVGKLADLVVWSP-----------------------------------
1k6wA1          PI---TENSLDAEQGLVIPLIILPAENGFDALRR------------------------------------
1m7jA1          ---SSARRRIDVAGKVVSP---------------------------------------------------
1k6wA2          ----------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
2oodA1          ----------------------------------------------------------------------
2r8cA1          ---SSNAHVIDVKGKTIMPRIVPAHADVLVVDGNPLKS--------------------------------
2pajA2          ----------------------------------------------------------------------
1gkrA1          E----ASRTIDAGGKFVMPTLQVGSDA-------------------------------------------
2i9uA1          ----------------------------------------------------------------------
2i9uA2          ----------------------------------------------------------------------
2qs8A1          --SNDFEDYIDLRDHTVLPSIESGKLA-------------------------------------------
1j6pA1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
1dpmA           -----RINTVRGPITISEAGFTLTHEHIC-----GSSAGFLRAWPEFFGSRKALAEKALRRARAAGVRTI
1j6oA           ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
1xwyA1          ----------------------------------------------------------------------
2amxA1          ----------------------------------------------------------------------
1m7jA2          ----------------------------------------------------------------------
2f6kA1          ----------------------------------------------------------------------
2r8cA2          ----------------------------------------------------------------------
1a4lA           DTVEELRNIIGMDKPLSLPGFLAKFDYYMPVIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANS
2qs8A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GSWIPAQFAENRAPTVAELSHALPDHPAYIQYLYDYALVNQRGIDVLGLNDTPPPDLAGIGVERDAKGSA
2a3lA1          ----------------------------------------------------------------------
1gkpA1          GQFVGEKGWGKLLRR-------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1a4lA           ----------------------------------------------------------------------
1onwA1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
1k6wA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1k6wA2          ----------------------------------------------------------------------
2oofA1          ----------------------------------------------------------------------
2oodA1          ----------------------------------------------------------------------
2r8cA1          ----------------------------------------------------------------------
2pajA2          ----------------------------------------------------------------------
1gkrA1          ----------------------------------------------------------------------
2i9uA1          ----------------------------------------------------------------------
2i9uA2          ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
1dpmA           VDVSTFDIGRD-VSLLAEVSRAADVH-----------IVAATGLWFDPPLSMRLRSVEELTQFFLREIQY
1j6oA           ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
1xwyA1          ----------------------------------------------------------------------
2amxA1          ----------------------------------------------------------------------
1m7jA2          ----------------------------------------------------------------------
2f6kA1          ----------------------------------------------------------------------
2r8cA2          ----------------------------------------------------------------------
1a4lA           KVDPMPWNQTEGDVTPDDVVDLVNQGLQEGEQAFGIKVRSILCCM-------------------------
2qs8A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           TGKLFGDIAAFNQLFASISSNADREGGLRQFFADMNARGVTGIIDPSAGPAAAYEPLFAMRNQGDLPLRV
2a3lA1          ----------------------------------------------------------------------
1gkpA1          ----------------------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1a4lA           -----------------------------EFVEMKAKEGVVYVEVYSPHLLANSKVDPMPWNQTEGDVTP
1onwA1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
1k6wA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1k6wA2          --------------RKALLTHDDVKQRAWQTLKWQIANGIQHVRTVSDATLTALKAMLEVKQEVAPWIDL
2oofA1          ----------------------------------------------------------------------
2oodA1          ----------------------------------------------------------------------
2r8cA1          ----------------------------------------------------------------------
2pajA2          -------------------DERRFRLAARIGLIELARSGCATVADYPGMPFDSSAILFEEAEKLGLRFVL
1gkrA1          ----------------------------------------------------------------------
2i9uA1          ----------------------------------------------------------------------
2i9uA2          ----------------------------GRLIKDLIKNGTTRVALFATLHKDSTIELFNMLIKSGIGAYV
2qs8A1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
1dpmA           GIEDTGIRAGIIKVATTGKATPFQELVLKAAARASLATGVPVTTHTAASQRDGEQQAAIFESEGLSPSRV
1j6oA           --------------------------------SSFEENNIEFVVNVGVNLEDSKKSLDLSKTSDRIFCSV
2icsA1          ----------------------------------------------------------------------
1xwyA1          ------------------------AKDRDDVVACAFDAGVNGLLITGTNLRESQQAQKLARQYSSCWSTA
2amxA1          ----------------------------------------------------------------------
1m7jA2          ----------------------------------------------------------------------
2f6kA1          ----------------------------------------------------------------------
2r8cA2          ----------------------------------------------------------------------
1a4lA           ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GYRIPVQPEAKGHEAQWFSNLMAFRPARADDGQLAFLGLGESLVAGMNDGVRMAPGFSSSDQDKTALRQV
2a3lA1          ------------------------------------------------------------------LNKL
1gkpA1          ----------------------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1a4lA           DDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSLEVLELCKKYNQKTVVAMDLAGDETIEGSGHVEA
1onwA1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
1k6wA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1k6wA2          QIVAFPQEGI-------------LSYPNGEALLEEALRLGADVVGAI-PHFEFTREYGVES-----LHKT
2oofA1          ----------------------------------------------------------------------
2oodA1          ----------------------------------------------------------------------
2r8cA1          ----------------------------------------------------------------------
2pajA2          LRGGATQTRQLEAD--LPTALRPETLDAYVADIERLAARYHDASPRAMRRVVMAPTTVLYSISPREMRET
1gkrA1          ----------------------------------------------------------------------
2i9uA1          ----------------------------------------------------------------------
2i9uA2          GK------------VNMDYNCPDYLTENYITSLNDTEEIILKYKDKSNIVKPIITPRFVPSCSNELMDGL
2qs8A1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
1dpmA           C---------------------------------------------------------------------
1j6oA           G----VHPDAKEVPEDFIEHLEKFA----KDEKVV--AIGET-------GLDFFRNISPAEVQKRVFVEQ
2icsA1          ----------------------------------------------------------------------
1xwyA1          GV----------HPHDSSQWQAATEEAIIELAAQPVVAIGEC-------GLDFNRNFSTPEEQERAFVAQ
2amxA1          ----------------------------------------------------------------------
1m7jA2          ----------------------------------------------------------------------
2f6kA1          -----------------------------PYELDAVKTVQQALDQDGALGVTVPTNSRGLYFGSPVLERV
2r8cA2          ------------------------------------------------------------------IRAI
1a4lA           ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ATFAAKRGIPLEIHAYTDDSADAILTIFEQVAQQYDLRPLRWSIAHLNTGSPQTLERMRKLGLAYTVQMG
2a3lA1          RESKGMTTITLRPHSGEAGDIDHLAATF--------LTCHSIAHGINLRKSPVLQYLYYLAQIGLAMSPL
1gkpA1          ----------------------------------------------------------------------
2bb0A1          ----------------------------------------------------------------------
2gokA1          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1a4lA           YEGAVKNGIHRTVHAGEVGS------PEVVREAVDILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPW
1onwA1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
1k6wA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1k6wA2          FALAQKYDRLIDVHCDEIDDEQSRFVETVAALAHHEGMGARAMHSYNGAYTSRLFRLLKMSGINFVANPL
2oofA1          ----------------------------------------------------------------------
2oodA1          ----------------------------------------------------------------------
2r8cA1          ----------------------------------------------------------------------
2pajA2          AAVARRLGLRMHSHLSGKSPVA--------FCGEHDWLGSDVWYAHLVKVDADEIALLAQTGTGVAHCPQ
1gkrA1          ----------------------------------------------------------------------
2i9uA1          ----------------------------------------------------------------------
2i9uA2          GKLSYKYRLPVQSHLSENLDEKKSNFYGEVYDKFGLFGNTPTLMAHCIHSSKEEINLIKRNNVTIVHCPT
2qs8A1          ----------------------------------------------------------------------
1j6pA1          ----------------------------------------------------------------------
1un7A1          ----------------------------------------------------------------------
2p9bA1          ----------------------------------------------------------------------
1dpmA           ----------------------------------------------------------------------
1j6oA           IELAGKLNLPLVVHIR--DAYSEAYEILR----TESLPEKRG-VIHAFSSDYEWAKKFIDLG--------
2icsA1          ----------------------------------------------------------------------
1xwyA1          LRIAADLNMPVFMH--CRDAHERFMTLLEPWLDKLPGA-----VLHCFTGTREEMQACVAHGIYIGITGW
2amxA1          ---VRDHGLHLTVHAGEDATLPNLNTLYTAIN---ILNVERIGHGIRVSESDELIELVKKKDILLEVCPI
1m7jA2          ----------------------------------------------------------------------
2f6kA1          YQELDARQAIVALHPNEPAILPKNVDIDLPVPLLGKYPNIKVIIPHAGAFLGIVDDRI------------
2r8cA2          VAEAQGRGTYVLAHAYTPAAIRAVRCGVR-------------TIEHGNLIDDETARLVAEHGVVPTLVTY
1a4lA           ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           PYFEGLAIRDANPPGATDNSPPVRLALDKGLVVAGGTDSTRIGIAGVWHAIEYHITGIASGGSVRKPASE
2a3lA1          SNN---------SLFLDYHRNPFPVFFLRGLNVSLSTD----------DPLQIHLTKEPLVEEYSIAASV
1gkpA1          ----------------------------------------------------------------------
2bb0A1          --------------------QIDTILINIGQLLTMESSGPRAGSMQDLHVIEDAVVGIHEQK--------
2gokA1          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1a4lA           SSYLTGAWDP-------KTTHAVVRFKNDKANYSLNTDDPLIFKSTLDTD-------------YQMTKKD
1onwA1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
1k6wA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1k6wA2          VNI--HLQGRFDTYPKRRGITRVKEMLESGINVCFGHDDVFDP--WYPLGTANMLQVLHMGL-HVCQLMG
2oofA1          -----------------------------CERVWLNVTPATLRSDLADYGLLEPHALGVHEG--------
2oodA1          --------------------------TTVGIRGTFFDFVDPWKHIGNEQAAARFHQD---GLXVVTDGVI
2r8cA1          ----------------------------------------------------------------------
2pajA2          ----------------SNGRLPVREMADAGVPVSIGVDGAASNEAADMISEVHMTWLAQRAR--------
1gkrA1          ----------------------------------------------------------------------
2i9uA1          ---------------------------------------------------------------------G
2i9uA2          S-----------NFNLGSGMMPVRKYLNLGINVVLGSDISAGHTCSLFKVIAYAIQ-----------NSK
2qs8A1          ----------------------------------------------------------------------
1j6pA1          ---------------------------------------------------------------------E
1un7A1          ---------------------------------------------------------------------S
2p9bA1          ---------------------------------------------------------------------D
1dpmA           ----------------------------------------------------------------------
1j6oA           ----------------------------------------------------------------------
2icsA1          ----------------------------------------------------------------------
1xwyA1          VCDEGLELRELLP---------------------------------------------------------
2amxA1          SNLLLNNVKSM-------DTHPIRKLYDAGVKVSVNSD--------------------------------
1m7jA2          ----------------------------------------------------------------------
2f6kA1          ----------------------------------------------------------------------
2r8cA2          DALASEGEKYGLPPESIAKIASIEIMKRAGVKMGFGTDL--LGEAQRLQSDEFRI------------LAE
1a4lA           ----------------------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RLTRLEALALYTRHAAWLAFAEQHRGQLSVGKQADLAVLNQPFMTMPEDRIDTIRAVLTLVDGRIVHESP
2a3lA1          WKLSACDLCEIARNSVYQSGFSHALKSHWIGKDYYKRGPNDIHKTNVPHIRVEFRDQQVYLGKAVISD--
1gkpA1          ----------------------------------------------------------------------
2bb0A1          IVFAGQKGAEAGYEADEIIDCSGRLVTLKAGRSADLVIWQAPNYMYIPYHYGVNHVHQVMKNGTIVVN--
2gokA1          ----------------------------------------------------------------------
1xrfA1          ----------------------------------------------------------------------
3be7A1          ----------------------------------------------------------------------
1a4lA           MGFTEEEFKRLNINAAKSSF--------------------------------------------------
1onwA1          ----------------------------------------------------------------------
2ftyA1          ----------------------------------------------------------------------
1ymyA1          ----------------------------------------------------------------------
1a5kC1          ----------------------------------------------------------------------
1k6wA1          ----------------------------------------------------------------------
1m7jA1          ----------------------------------------------------------------------
1k6wA2          YGQINDGLNLITHHSARTLNLQ--DYGIAAGNSAN-----------------------------------
2oofA1          -RIHALVPXQDLKYPAHWQDXKGKLVTLRVGXLADFLVWNCGHPAELSYLIGVDQLVSRVVNGEET----
2oodA1          KAFGPYEKIAAAHPGVEITHIKDRIIVFEPGKEADFVALDNGGQLAQPWHQSLIGADETWVXGKRLYK--
2r8cA1          ----------------------------------------------------------------------
2pajA2          LASIAEVIHWGTAGGA------------------------------------------------------
1gkrA1          ----------------------------------------------------------------------
2i9uA1          KIASVSSNLPDKYKGNPIIDFRNNIIIFEEGYDFDALVINDSNLYPEDYDLDDRNIMKRYVCGNEI----
2i9uA2          IKWQESGKKDMFLSTS------------------------------------------------------
2qs8A1          ----------------------------------------------------------------------
1j6pA1          NGTIKRVLQGEVKVDLD-LSGKLVXPKIEEGWNADLVVIDDLPEXFPVQNIFSGEVFATXVAGKWIYFDG
1un7A1          TERPKEPYSKEIQAPADSV----LLPSVTVGKDADLVIVSSDC-----------EVILTICRGNIAFISK
2p9bA1          GRIEQVAPSIETSIPAEYHYLDGTIVXLEVGKSADLLVLNANP---LDDLRALEHPALVIAAGHPVWR--
1dpmA           ----------------------------------------------------------------------
1j6oA           ----------------------------------------------------------------------
2icsA1          ----------ISGSAKELEPGTYVSATLEIGKDADLTIFTQAEEKTLTDSNGLIRPIKTIIGGQIYD---
1xwyA1          ----------------------------------------------------------------------
2amxA1          ----------------------------------------------------------------------
1m7jA2          --------------------------QVQPGYYADLVVFATVADSATFETERAAGIHSVYVNGAAVWE--
2f6kA1          ----------------------------------------------------------------------
2r8cA2          VLSPAEVIASATIVSA------------------------------------------------------
1a4lA           ----------------------------------------------------------------------
2qs8A1          -----GFISSNDFEDYIDLRDHTVLPSIESGKLADLIAVKGN----PIEDISVLENVDVIKDGLLY----


                         .         .         .         *         .         .         .:630
query           DLNAxx
2a3lA1          ------
1gkpA1          ------
2bb0A1          ------
2gokA1          ------
1xrfA1          ------
3be7A1          ------
1a4lA           ------
1onwA1          ------
2ftyA1          ------
1ymyA1          ------
1a5kC1          ------
1k6wA1          ------
1m7jA1          ------
1k6wA2          ------
2oofA1          ------
2oodA1          ------
2r8cA1          ------
2pajA2          ------
1gkrA1          ------
2i9uA1          ------
2i9uA2          ------
2qs8A1          ------
1j6pA1          EYPT--
1un7A1          EAD---
2p9bA1          ------
1dpmA           ------
1j6oA           ------
2icsA1          ------
1xwyA1          ------
2amxA1          ------
1m7jA2          ------
2f6kA1          ------
2r8cA2          ------
1a4lA           ------
2qs8A1          ------