[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF67677.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fug61.bssp"
#ERROR : Can't open dsspfile "1cc1S.bssp"

## Summary of PDB Search
:220
    7e-51  51%  2fug61 [e.19.1.2] NADH-QUINONE OXIDOREDUCTASE CHAIN 6 6:15 -- 175
    4e-27  18%  1cc1S  [e.19.1.1] HYDROGENASE (SMALL SUBUNIT)
:220

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKNVFMGKLHDMVNWGRKNSIWPYNFGLSCCYVEMVT
2fug61          ----------------------------------EGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMM-
1cc1S           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYS
2fug61          ----------------ASTDAQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYA
1cc1S           --------------VEGAIPTAKECIVGEAKAHHHEVTMMELIRDLAPKSLATVAVGTCSAYGGIPKSVR


                         +         .         .         .         .         *         .:210
query           VVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIGKERRPLSWVVGDQGVYRxxxxxxxxxxxxxxxx
2fug61          IVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAYNERG-------------------------
1cc1S           DFFADEKIEKLLVNVPGCPPHPDWMVGTLVAAWSHVLNPTEHPLPELDDDGRPL----------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxx
2fug61          ----------
1cc1S           ----------