[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF67711.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dd8A1.bssp"
#ERROR : Can't open dsspfile "1tqyB2.bssp"
#ERROR : Can't open dsspfile "1e1cA1.bssp"
#ERROR : Can't open dsspfile "1tqyA2.bssp"
#ERROR : Can't open dsspfile "1itkA1.bssp"
#ERROR : Can't open dsspfile "1b8fA.bssp"
#ERROR : Can't open dsspfile "1b3nA1.bssp"
#ERROR : Can't open dsspfile "1tqyA1.bssp"
#ERROR : Can't open dsspfile "1b3nA2.bssp"
#ERROR : Can't open dsspfile "1tqyB1.bssp"
#ERROR : Can't open dsspfile "1afwA2.bssp"
#ERROR : Can't open dsspfile "1ekrA.bssp"
#ERROR : Can't open dsspfile "2ebfX2.bssp"
#ERROR : Can't open dsspfile "1dluA1.bssp"
#ERROR : Can't open dsspfile "1pucA.bssp"
#ERROR : Can't open dsspfile "1wd6A.bssp"
#ERROR : Can't open dsspfile "1fjgE1.bssp"
#ERROR : Can't open dsspfile "2hpuA1.bssp"
#ERROR : Can't open dsspfile "1qhbA.bssp"
#ERROR : Can't open dsspfile "1e1cB1.bssp"
#ERROR : Can't open dsspfile "1eblA2.bssp"
#ERROR : Can't open dsspfile "2h7bA1.bssp"
#ERROR : Can't open dsspfile "2aehA2.bssp"
#ERROR : Can't open dsspfile "1u0mA1.bssp"
#ERROR : Can't open dsspfile "1jdwA.bssp"
#ERROR : Can't open dsspfile "1js1X2.bssp"
#ERROR : Can't open dsspfile "1hnkA2.bssp"
#ERROR : Can't open dsspfile "1tedA.bssp"
#ERROR : Can't open dsspfile "1l5jA3.bssp"
#ERROR : Can't open dsspfile "1q5fA.bssp"
#ERROR : Can't open dsspfile "1afwA1.bssp"

## Summary of PDB Search
:404
    2e-90  91%  1dd8A1 [c.95.1.1] BETA-KETOACYL [ACYL CARRIER PROTEIN] SYNTHASE I
    2e-48  23%  1tqyB2 [c.95.1.1] ACTINORHODIN POLYKETIDE PUTATIVE BETA-KETOACYL
    2e-47  10%  1e1cA1 [c.1.19.1] METHYLMALONYL-COA MUTASE ALPHA CHAIN A:2 -- 560
    1e-35  33%  1tqyA2 [c.95.1.1] BETA-KETOACYL SYNTHASE/ACYL TRANSFERASE A:219 --
    3e-35  10%  1itkA1 [a.93.1.3] CATALASE-PEROXIDASE A:18 -- 423
    3e-35  12%  1b8fA  [a.127.1.2] HISTIDINE AMMONIA-LYASE
    1e-32  29%  1b3nA1 [c.95.1.1] PROTEIN (KETOACYL ACYL CARRIER PROTEIN SYNTHASE
    2e-28  24%  1tqyA1 [c.95.1.1] BETA-KETOACYL SYNTHASE/ACYL TRANSFERASE A:3 --
    4e-28  42%  1b3nA2 [c.95.1.1] PROTEIN (KETOACYL ACYL CARRIER PROTEIN SYNTHASE
    3e-27  19%  1tqyB1 [c.95.1.1] ACTINORHODIN POLYKETIDE PUTATIVE BETA-KETOACYL
    2e-22  14%  1afwA2 [c.95.1.1] 3-KETOACETYL-COA THIOLASE A:294 -- 417
    1e-20  10%  1ekrA  [d.58.21.1] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN C
    3e-19   9%  2ebfX2 [c.150.1.2] DERMONECROTIC TOXIN X:875 -- 1093
    4e-18  12%  1dluA1 [c.95.1.1] BIOSYNTHETIC THIOLASE A:4 -- 268
    2e-16   8%  1pucA  [d.97.1.1] P13SUC1
    8e-16  12%  1wd6A  [d.58.4.12] PROTEIN YDHR
    3e-15  18%  1fjgE1 [d.14.1.1] 30S RIBOSOMAL PROTEIN S5 E:74 -- 154
    1e-14  16%  2hpuA1 [d.357.1.1] NOSL PROTEIN A:35 -- 160
    4e-14   7%  1qhbA  [a.111.1.2] HALOPEROXIDASE
    1e-13   7%  1e1cB1 [c.1.19.1] METHYLMALONYL-COA MUTASE BETA CHAIN B:20 -- 475
    5e-13  15%  1eblA2 [c.95.1.2] BETA-KETOACYL-ACP SYNTHASE III A:175 -- 317
    5e-12  10%  2h7bA1 [a.277.1.1] CORE-BINDING FACTOR, ML1-ETO A:1 -- 103
    5e-11  12%  2aehA2 [b.55.1.5] FOCAL ADHESION KINASE 1 A:254 -- 363
    2e-09  11%  1u0mA1 [c.95.1.2] PUTATIVE POLYKETIDE SYNTHASE A:2 -- 201
    5e-09  10%  1jdwA  [d.126.1.2] L-ARGININE\:GLYCINE AMIDINOTRANSFERASE
    8e-09   4%  1js1X2 [c.78.1.1] TRANSCARBAMYLASE X:164 -- 324
    1e-08  14%  1hnkA2 [c.95.1.2] BETA-KETOACYL-ACYL CARRIER PROTEIN SYNTHASE III
    1e-06  15%  1tedA  [c.95.1.2] PKS18
    9e-06  16%  1l5jA3 [c.83.1.1] ACONITATE HYDRATASE 2 A:373 -- 862
    3e-05  12%  1q5fA  [d.24.1.1] PILS
    2e-04  25%  1afwA1 [c.95.1.1] 3-KETOACETYL-COA THIOLASE A:25 -- 293
:404

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMRSQVWGNVKLDTTGLIDRKVVRFMSD
1dd8A1          MKRVVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSD
1tqyB2          ----------------------------------------------------------------------
1e1cA1          AFRPWTIRQYAGFSTAESNAFYRRNLAAGQKGLSAFDLPTHRGDVGMAGVAIDFAGIPLDQMSVSMTMNG
1tqyA2          ----------------------------------------------------------------------
1itkA1          ----------------------------------------------------------------------
1b8fA           -------------------------------------------------------------------AED
1b3nA1          -RRVVVTGLGMLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKFNCEDIISRKEQRKMDA
1tqyA1          -RRVVITGVGVRAPGGNGTRQFWELLTSGRTATRRISFFDPSPYRSQVAAEADFPVAEGFGPRELDRMDR
1b3nA2          ----------------------------------------------------------------------
1tqyB1          ----LITGVGVVAPNGLGLAPYWSAVLDGRHGLGPVTRFDVSRYPATLAGQIDFHAPDHIPGRLLPQTDP
1afwA2          ----------------------------------------------------------------------
1ekrA           ----------------------------------------------------------------------
2ebfX2          ----------------------------------------------------------------------
1dluA1          ----------------------------------------------------------------------
1pucA           ----------------------------------------------------------------------
1wd6A           ----------------------------------------------------------------------
1fjgE1          ----------------------------------------------------------------------
2hpuA1          ----------------------------------------------------------------------
1qhbA           DPDDFLAFVRAINS-GDEKEIAALTLGPARDPETGIWRSDLANSGWENSSAGLTFDLEGPDPAPVLTSPE
1e1cB1          ----------------------------------------------------------------------
1eblA2          ----------------------------------------------------------------------
2h7bA1          ----------------------------------------------------------------------
2aehA2          ----------------------------------------------------------------------
1u0mA1          ---ATLCRPSVSVPEHITMEETLELARRRHTDHPQLPLALRLIENTGVRTREDTLEHPGFEDRNKVYERE
1jdwA           ----------------------------------------------------------------------
1js1X2          ----------------------------------------------------------------------
1hnkA2          ----------------------------------------------------------------------
1tedA           --VAVIEGLATTPRRVVNQSDAADRVAELGQRERIPRVYQKSRITTRRMAVDPLDAPATIRDRMHLFYEH
1l5jA3          ----------------------------------------------------------------------
1q5fA           ----------------------------------------------------------------------
1afwA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAGSGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMAS
1dd8A1          ASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMAS
1tqyB2          ----------------------------------------------------------------------
1e1cA1          AVLPILALYVVTAEEQGVKPEQLAGT-IQNDILKEFMVRNTYIYPPQPSMR-------------------
1tqyA2          ----------------------------------------------------------------------
1itkA1          ----------------------------------------------------------------------
1b8fA           RTAYGINTGFGLLASTRIASHDL-ENLQRSLVLSHAAGI--GAPLDDDLVRIMVLKINSLSRGFSGIRRK
1b3nA1          FIQYGIVAGVQAMQDSGLEITEE-NATRIGAAIGSGIGGLGLIEENHTSLMN-GGPRKISPFFVPSTIVN
1tqyA1          ASQFAVACAREAFAASGLDPDTL-DPARVGVSLGSAVAAATYLLLSDSGRDWEVDAAWLSRHMFDYLVPS
1b3nA2          ----------------------------------------------------------------------
1tqyB1          STRLALTAADWALQDAKADPESL-TDYDMGVVTANACGGFDFTHREFRKLWS-EGPKSVSVYESFAWFYA
1afwA2          ----------------------------------------------------------------------
1ekrA           ----------------------------------------------------------------------
2ebfX2          -------------------------------------------------------------------TYR
1dluA1          ----------------------------------------------------------------------
1pucA           ----------------------------------------------------------------------
1wd6A           ----------------------------------------------------------------------
1fjgE1          ----------------------------------------------------------------------
2hpuA1          ----------------------------------------------------------------------
1qhbA           LIAEMAELYLMALGRDIEFSEF--DSPKNAAFIRSAIERLN--------GLEWFNTPAKLGDPPAEIRRR
1e1cB1          -------------------------------------------------------IGEVFGVDEDKRGAR
1eblA2          ----------------------------------------------------------------------
2h7bA1          ----------TTLQQFGNDISPE-IGERVRTLVLGLVNSTLTIEEFHSKLQE-ATNFPLRPFVIPFLKAN
2aehA2          ---------KCALGSSWIISV--------ELAIGPEEGISYLTDKGANPTHLADF---NQVQTIQYSNSE
1u0mA1          AKSRVPAVIQRALDDAELLATDIDV-IIYVSCTGFMMPSLTAWLINEMGFDSTTR---------------
1jdwA           ----------------------------------------------------------------------
1js1X2          ----------------------------------------------------------------------
1hnkA2          ----------------------------------------------------------------------
1tedA           AVPLAVDVSKRALAGLPYRAAEIG-----LLVLATSTGF---------------IAPGVDVAIVKELGLS
1l5jA3          ----------------------------------------------------------------------
1q5fA           --------------------------------------------------------------MWGKKDAG
1afwA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GVSACLATPFKIYGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
1dd8A1          GVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTK
1tqyB2          ----------------------------------------------------------------------
1e1cA1          -IISEIFAYTSANMPKWNSISISGYAMQEAG----ATADIEMAYTLADGVDYIRAGES--------VGLN
1tqyA2          ----------------------------------------------------------------------
1itkA1          -------APINSWPDNANLDKARR-LLLPIKQKYGQKISWADLMILAGN------------VAIESMGFK
1b8fA           VIDALIALVNAEVYPHIPLKGSVGASGDLAPLAH-------MSLVLLGEGK--ARYKGQWLSATEALAVA
1b3nA1          MVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALST
1tqyA1          VMPAEVAWAVGAEGPVTMVSTGCTSGLDSVGNAVRAIEEGSADVMFAGAADTITPIVVACFDAIRATTAR
1b3nA2          ----------------------------------------------------------------------
1tqyB1          VNTGQISIRHGMRGPSSALVAEQAGGLDALGHARRTIRRG-TPLVVSGGVDSALWGWVS-QIASGRIST-
1afwA2          ----------------------------------------------------------------------
1ekrA           ----------------------------------------------------------------------
2ebfX2          GVAFNSSKSIDFFLNNLTTFIDNGLTEIAISDLPYDIVQQEISQFLQGSNEWKTLKGDINGAFRKLLQ-S
1dluA1          ---AAMKAGVPQEATAWGMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESMSMAPHCAHLRGGVKMGD
1pucA           ----------------------------------------------------------------------
1wd6A           ------------------------------------------------------------AEQLKPLAES
1fjgE1          ----------------------------------------------------------------------
2hpuA1          ----------------------------------------KAQIFLEGSPAPLFFSVRDAIAYARGPLVI
1qhbA           RGEVTVGNLFRGILPGSEVGPYLSQFIIVGSKQIGSATVGNKTLVSPNAADFDGEIAYGSITISQRVRIA
1e1cB1          QNAITSWRELTREDPYVNILRGSIATFSASVGGAESITTLPFTQALGLPEDDFPLRIARNTGIVLAEEVN
1eblA2          ----------------------------------------------------------------------
2h7bA1          LPLLQRELLHAARLAKQNPAQYLAQHEQLLLDA-------------------------------------
2aehA2          DKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMA--DLIDGYCRLVNGATQS-------------------
1u0mA1          --------------QIPIAQLGCAAGGAAINRAHDFCTAYPEANALIVACEFCSLCYQPTDLGVGSL---
1jdwA           ----------------------------------------------------------------------
1js1X2          ----------------------------------------------------------------------
1hnkA2          ----------------------------------------------------------------------
1tedA           PSISRVVV----------NFMGCAAAMNALGTATNYVRAHPAMKALVVCI-ELCSVNAVFADDINDVVIH
1l5jA3          ----------------------------------------------------------------------
1q5fA           TELTNYQT-LATNTIGMMKGVDGYAFTSGAKMTDTLIQAGAAKGMTVSGDP-------------------
1afwA1          ---ACLASGIPYSTPFVALNRQCSSGLTAVNDIANKIKVGQIDIGLALGVE-------------------


                         .         .         .         +         .         .         .:280
query           YNDTPEKASRTYDAHRDXXXXXXXXXXXXXEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRC
1dd8A1          YNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHI---------------------------
1tqyB2          ----PDRAYLPFDERAAGYVPGEGGAILVLEDSAAAEARGRHAYGELAGCASTFDPAPG-SGRPAGLERA
1e1cA1          VDQFAPRLSFFWGIGMNFFMEVAKLRAA--RMLWAKLVHQFGPKNPKSSLRTHSQTSGWSLTAQDVYNNV
1tqyA2          --DDPEHASRPFDGTRDGFVLAEGAAMFVLEDYDSALARGARIHAEISGYATRCNAYHMTGLKGREMAET
1itkA1          TFGYAGGREDAFEEDKAVNWGPEDEFETQ-ERFDEPGEIQEGLGASVMGLIYVNPEGPDGNPDASAKNIR
1b8fA           GLEPLTLAAKEGLALLNGTQASTAYALRGLFYAEDLYAAAIACGGLSVEAVLGSRSPFDARIHEARGQRG
1b3nA1          RNDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGA-----------------------------
1tqyA1          ----------------------------------------------------------------------
1b3nA2          ------------------------------------------IYAELVGFGMSSDAYHMTPENGAGAALA
1tqyB1          ----------------------------------------------------------------------
1afwA2          ---------------------------------------NLPVLGRYIDFQTVGVPPEIMGVGPAYAIPK
1ekrA           ----------------------------------------------------------AHMVDVSAKAET
2ebfX2          AKDNNIKFRAIGHSDNSVPPFNNPYKSLYYKGNIIAEAIEKLDREGQKFVVFADSSLLNSTPGTGRPMPG
1dluA1          FKMIDTMIKDGLTDAFYYHMGTTAENVAKQWQLSRDEQDAFAVASQNKAEAAQKDGVPFIVKGRKGDITV
1pucA           ----------------------------------------------------------------------
1wd6A           INQEPGFLWKVWTESEKNHEAGGIYLF---TDEKSALAYLEKHTARLKNLGVEEVVAKVFDVNEPL----
1fjgE1          ----------------------------------------GTIPHEIEVEFGASKIVLKPAAPGTGAGAV
2hpuA1          YVNDMGAAGATWDQPGDGNWIAADKAFYVVG----SARRGGMGAPEAVPFSSRDEAAAFVLLALADITDA
1qhbA           TPGRDFMTDLKVFLD-------------------------------------------------------
1e1cB1          IGRVNDPAGGSYYVESLTRSL-----------ADAAWKEFQEVEKLGGMSKAVMTETKVLDACNAERAKR
1eblA2          ------------------------------TLPNADRVNPENSIHLTX------AGNEVFKVAVTELAHI
2h7bA1          ----------------------------------------------------------------------
2aehA2          ----------------------------------------------------------------------
1u0mA1          ----------------------------------------------------------------------
1jdwA           ------------------------------ANEVPIQKMFEKLGITTIKV----NIRNANS--LGGGFHC
1js1X2          ----------------------------------------------------------------------
1hnkA2          -------------------------------------------------------STHLHADGSTELAHI
1tedA           SLFGDGCAALVIGASQVQEKLEPGKVVVRSSFSQLLDNTEDGIVLGVNHNGITCELSENLGYIFSGVAPV
1l5jA3          ----------------------------------------------------------------------
1q5fA           ----------------------------------------------------------------------
1afwA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           MQMAMHGVDTPIDYLNSHGTSTPVGDVKELGAIREVFGDNSPAISATKAMTGHSLGAAGVQEAIYSLLML
1dd8A1          ----------------------------------------------------------------------
1tqyB2          IRLALNGTGEDVDVVFADGAGVPELDAAEARAIGRVFGREGVPVTVPKTTTGRLYSGGGPLDVVTALMSL
1e1cA1          VRTCIE----AMAATQGHTQSLHTNSLDEAIALPTDFSARIALFLQQESGTTRVIDPWSGSAYVEELTDL
1tqyA2          IRVALDESRTDIDYINAHGSGTRQNDRHETAAYKRALGEHATPVSSIKSMVGHSLGAIGSLEIAACVLAL
1itkA1          QTFDRMAKETAALIAGGHTFGKVHGADDPEENLGPEPEAAPITQSPTEWDMGYINNLLDYEWEPEKGPGG
1b8fA           QIDTADLLGDSSEVSLSHKNADKVQDPYSLRCQPQVMGACLTAAEVLGIEANAVSDNPLVFAAEGDVISG
1b3nA1          ----------------------------------------------------------------------
1tqyA1          ----------------------------------------------------------------------
1b3nA2          MALRDAGIEASIGYVNAHGTSTPAGDKAEAQAVKTIFGEAASLVSSTKSMTGHLLGAAGAVESIYSILAL
1tqyB1          ----------------------------------------------------------------------
1afwA2          VLEATGLQVQDIDIFEINEAFAAQALYCIHKLGIDLNKVN---PRGGAIALGHPLGCTGARQVATILREL
1ekrA           VREARAFVTRSETLAMIIDGRHHKGDVFATARIAGIQACHPLMLSKVEVNLQAEPEHNRVRIETLCRLTG
2ebfX2          LVQYLKIPATVDGAWQFLPDVASSRVPIE-----------------------------------------
1dluA1          DADELDSMAKLRPAFDKEGTVTAGNASGL-----------------------------------------
1pucA           -------------------------------SGVPRLLTASERLEPFIDQIHYSPRYADDE------YEY
1wd6A           ----------------------------------------------------------------------
1fjgE1          PRAILELAGVTDILTKELGSRNPINIAYAMEALRQLRT--------------------------------
2hpuA1          MVLTPV----------------------------------------------------------------
1qhbA           ----------------------------------------------------------------------
1e1cB1          LANRKQPITAVSEFPMIGAR--------------------------------------------------
1eblA2          VDETLAANNNDLDWLVPHQANLRIIS-----ATAKKLGXSXDNVVVTLDRHGNTSAASVPCALD---EAV
2h7bA1          ----------------------------------------------------------------------
2aehA2          ----------------------------------------------------------------------
1u0mA1          ----------------------------------------------------------------------
1jdwA           WTCDVRRRGTLQSYLD------------------------------------------------------
1js1X2          -------------------------------TWAPHPRP-------LPQAVPNSFAEWMNATDYEFVITH
1hnkA2          VDETLANLDRSLDWLVPHQANLRIIS-----ATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDE---AV
1tedA           VTEMNGLQISDIDLWAIHPGGPKIIEVRSLGISAELA----AQSWDVLARFGNMLSVSLIFVLETMVQQA
1l5jA3          -----------------ILCAP--NDPDDARPLSAVQGEKIDFIGSCMTNIGHFRAAGKLLDAHKGQLPT
1q5fA           ----------------------------------------------------------------------
1afwA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EHGFIAPSINIEELDEQAAGLNIVXXXXXXXXXXVMSNSFGFGGTNATLVMRKL
1dd8A1          ------------------------------------------------------
1tqyB2          REGVIAPTAGVTSVPREYGIDLVLGEPRSTAPRTALVLARGRWGFNSAAVLRR-
1e1cA1          ARKAWGHIQEVEKVGGMAKAKMRIEEAAARTQARIDSGRQPLIGVNKYRLEH--
1tqyA2          EHGVVPPTANLRTSDPECDLDYVPLEARERKLRSVLTVGSGFGGFQSAMVLRD-
1itkA1          AWQWAPKSEELKNSVPDAHDLTTDIALKRDPDYREVMETFQENPMEFGMNFAK-
1b8fA           GNFHAEPNLALAIAEIGSLSERRISLMMDKHMSQLPPFLVENGGVNSGFMIAQ-
1b3nA1          ------------------------------------------------------
1tqyA1          ------------------------------------------------------
1b3nA2          RDQAVPPTINLDNPDEGCDLDFVPEARQVSGMEYTLCNSFGFGGTNGSLIFKKI
1tqyB1          ------------------------------------------------------
1afwA2          KKDQIGV----------------------------VSMCIGTGMGAAAIFIKE-
1ekrA           KTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSSGD----------
2ebfX2          ------------------------------------------------------
1dluA1          ------------------------------------------------------
1pucA           RHVMLPKAMLKAIPTDYTGTLRILQEEEWRGLGILGWEMYEVHVPEPHILLFK-
1wd6A           ------------------------------------------------------
1fjgE1          ------------------------------------------------------
2hpuA1          ------------------------------------------------------
1qhbA           ------------------------------------------------------
1e1cB1          ------------------------------------------------------
1eblA2          RDGRIKPG------------------------QLVLLEAFGGGFTWGSALVR--
2h7bA1          ------------------------------------------------------
2aehA2          ------------------------------------------------------
1u0mA1          ------------------------------------------------------
1jdwA           ------------------------------------------------------
1js1X2          PEGYELDPKFVGNQMKAFEGADFNWAAYTGDNYGQILSTDRNWTVGDRQMAVT-
1hnkA2          RDGRIKPGQLVLL-----------------------------------------
1tedA           ESA--------------------------KAISTGVAFAFGPGVTVEGMLFD--
1l5jA3          RLWVAPPTRMDAA-----------------------------------------
1q5fA           ------------------------------------------------------
1afwA1          ------------------------------------------------------