[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF67784.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1xkpA1.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "1puoA2.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1wz8A1.bssp"
#ERROR : Can't open dsspfile "1iw0A.bssp"
#ERROR : Can't open dsspfile "1nrjB.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1a2kC.bssp"

## Summary of PDB Search
:242
    2e-45  40%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    3e-39  17%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    3e-34  15%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    7e-33  18%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-33  26%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    6e-32  24%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-29  12%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    1e-29   9%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    2e-29  16%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    3e-29  11%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    6e-29  12%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    5e-28  11%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    4e-27  10%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    4e-27  16%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    3e-26  24%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    1e-25   7%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    5e-25  10%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    1e-24   9%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    2e-24  10%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    5e-24   9%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    1e-23   8%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    2e-23  11%  1rkbA  [c.37.1.1] PROTEIN AD-004
    1e-22  12%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    5e-22   9%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    6e-22   7%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    2e-21  15%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    2e-21  14%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    3e-21  11%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    6e-21  12%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    9e-21  13%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    2e-20  11%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    5e-20  10%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    5e-20  11%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    7e-20  12%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    9e-20  17%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    1e-19  10%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    1e-19  14%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    1e-19  10%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    2e-19  12%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    2e-19  15%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    2e-19  23%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    3e-19  11%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    5e-19  20%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    5e-19   7%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    1e-18  10%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    1e-18  12%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    1e-18   8%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    3e-18   7%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    4e-18   6%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    7e-18  10%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    1e-17   9%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    2e-17  15%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    4e-17  11%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    5e-17  10%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    5e-17  11%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    6e-17   6%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    1e-16  13%  1g6oA  [c.37.1.11] CAG-ALPHA
    2e-16   8%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    3e-16  16%  1t3wA  [a.236.1.1] DNA PRIMASE
    3e-16  12%  1oa8A  [b.145.1.1] ATAXIN-1
    4e-16  12%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    4e-16  17%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    4e-16  12%  1jbkA  [c.37.1.20] CLPB PROTEIN
    4e-16   9%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    6e-16   8%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    7e-16  10%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    7e-16  11%  1jb1A  [c.91.1.2] HPRK PROTEIN
    8e-16  15%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    1e-15  25%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-15   9%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    2e-15  13%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    3e-15  10%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    3e-15  14%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    4e-15  13%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    5e-15  10%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    5e-15  10%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    7e-15  12%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    9e-15  20%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    1e-14  12%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    4e-14   8%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    6e-14   9%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    9e-14  10%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    1e-13  13%  1g31A  [b.35.1.1] GP31
    1e-13  11%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    2e-13  12%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    3e-13  13%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    3e-13  13%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    4e-13  25%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    4e-13  13%  1sbxA  [a.6.1.4] SKI ONCOGENE
    7e-13  12%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    7e-13  22%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    1e-12  18%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    2e-12  12%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    2e-12   9%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    2e-12   6%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    2e-12  10%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    3e-12  11%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    3e-12   9%  1mi8A  [b.86.1.2] DNAB INTEIN
    8e-12  14%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    1e-11   8%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    1e-11  22%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    5e-11  12%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    7e-11  13%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    2e-10   8%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    3e-10  12%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    3e-10  10%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    4e-10   9%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    6e-10  16%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    1e-09  13%  1xkpA1 [a.243.1.3] PUTATIVE MEMBRANE-BOUND YOP TARGETING PROTEIN
    3e-09  17%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    4e-09  14%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    4e-09   9%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    5e-09  13%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    8e-09  10%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    9e-09  14%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    1e-08  12%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    2e-08   9%  1e6vC  [d.58.31.1] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    5e-08   9%  1puoA2 [a.101.1.1] MAJOR ALLERGEN I POLYPEPTIDE, FUSED CHAIN 2, A:5
    7e-08  12%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    2e-07  17%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    2e-07  16%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    2e-07  12%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    3e-07  13%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    4e-07  15%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    5e-07  12%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    6e-07   6%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    9e-07  13%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    1e-06  18%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
    1e-06  10%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    2e-06  12%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    4e-06   9%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    1e-05  14%  1wz8A1 [c.14.1.3] ENOYL-COA HYDRATASE A:2 -- 264
    2e-04  38%  1iw0A  [a.132.1.1] HEME OXYGENASE
    4e-04  15%  1nrjB  [c.37.1.8] SIGNAL RECOGNITION PARTICLE RECEPTOR BETA
    4e-04  42%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 --
    6e-04  14%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    0.001  39%  1a2kC  [c.37.1.8] RAN
:242

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSIQLNGINCFYGAHQALFDITLDCPEGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLTIAGNHFDFTK
1b0uA           --LHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVR
1sgwA           --LEIRDLSVGYD-KPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVP-----
1e69A           ---------------KSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPNGS
1q3hA           --EKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------
1ji0A           IVLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGK-----IIFNGQD
1l7vC           ----------------RLGPLSGEVRAGEILHLVGPNGAGKSTLLA-RXAGXTSGKGSIQFAGQ------
1m3eA1          ----------------DAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDNFG
1n25A           --------------YDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFEL
1ex6A           ----------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTT------
2yyeA2          --------------------------VGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALNDAR
1nijA1          ---------------------------IAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGEVSVD
1e9rA           -GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVD-------
1khbA1          -----------LAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDA
1s9hA           --LELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAI-AHTVPFYGCVNWTNENFPFND
1pf4A1          --VDVKDVTFTYKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICL--DGHDVRD
1t06A           ---------------KTVMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLNQEL------
1mukA           -------------------------------WRMCEAREPSVDLLPLCAGID-PLNSDPFLKM-------
1bmfA3          --IPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKK--LYCI
1ohcA1          -----------------------------------------------------DPQDDVYLDIT----DR
1jalA1          ---------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMP---
1urjA           ------------LYLVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPD---FSRV
1rkbA           ---------------------------LPNILLTGTPGVGKTTLGK--ELASKSGLKYINVGDLARE---
1jjvA           ---------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPLVDADVVAREVV--AK
1pv4A3          ---------------ARVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVL--LIDE
2gx8A1          ---------KKVVVFVPVTHAEEVRKALGDAGAGHIGNYSHCTFSSEGTGTFVPQQLE-RVEEVRIE-TI
1ffhA2          -------------------ARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
1qhlA           --GKFRSLT--LINWNGFFARTFDLDELVT-TLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKAGVCY
1zp6A1          --------------------------GGNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIKH
1e6cA           ----------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTS---
2axpA1          ------------------------------IILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAK----
1f46A           ---------------------------------------------EAVIIMNVAAHHGSELNG-------
1tljA           -------LVWEELREKALNKIYHDKEIGYLDPDILGF------LLAFYRNRNDV-YTQSSCSGRITIVDA
1bgxT2          ---------------------------------------------RGMLPLFEPKGRVLLVDG-------
1xbtA1          ---------------------------GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYA-----
1cr0A           ------SVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMG-----KKVGLAML
2gk3A1          ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2iqhA1          ----------AGLTHMMIWHSNLNDATYQRTRALVRTG-MDPRMCSLMQGSTLPRRSG--AAGAAVKGVG
1c4oA1          -TFRYRGPSPKGDQPKAIAGLVEALRDGERFVTLGATGTGKTVTMAKVIEALGRPAL-------VLAPNK
1zs3A1          --------------------------------------------------------------------KL
1f2t.1          -----------------------------------PSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAILE
1mjgM           RGIKLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGK---IEVIGPDIDQ
1vplA           -AVVVKDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPS------SGIVTVFGK
1j1zA2          ----------------------------------------------------------------------
1ak2A1          -------------------------PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASG
2vgmA3          ----------------------------------------------------------------------
1kgdA           ---------------------------RKTLVLLGAHGVGRRHIKNTLITKHPDRFA--YPIPHTTRPPE
1cd5A           GQVSFKHVVTFNMDYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYG
2f9hA1          ----------------------------------------------------------------------
1poiA           ----------------LKDAIAKYVHSGDHIALGGFTTDRKPYAA-VFEILRQGITD-LTGLGGAAGGDW
1afrA           --------------REVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDLNT
1viaA           ----------------------------KNIVFIGFXGSGKSTLARALA-------KDLDLVFLDSDFLI
1udwA           --------------------------EPFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLTS
1l3aA           ----------------------------------------------------------------------
1d6jA           -----------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAY--RLDGDNI
2v3jA1          -------------------VLTSKDKITKRXIVVLAXASLETHKIYVLLNC-DDHQGLLKKXGRDIS---
1g6oA           --EEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPK---------EERIISI
2qgmA1          ----------------------------------------------------------------------
1t3wA           ----------------------------------------KRTTXRILILVQNPELATLVPPLENLDE--
1oa8A           ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1ckvA           ----IMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTRAGYWWIKAN
1jbkA           LTERAEQGKLVIGRDEEIRRTVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALD
1grqA           ---------------------------TRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLI-----
3cddA1          ----------------------------------------------------------------------
1tmkA           ---------------------------GKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIGG
1jb1A           --------------RRSXHGVLVDIY-GLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQDEQT
1lw7A2          ---------------------------AKTVAILGGESSGKSVLVNKLAAVFNTTSAW--EYGREFVFEK
1g6hA           MELRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGR-----VYFENKD
1np6A           ---------------------------IPLLAFAAWSGTGKTTLLKKLIPALCAR--GIRPGLIKHTHHE
1es6A2          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2ancF1          --------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVD
1fl9A           QYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEE--
1bccF           ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
2gtlM1          --TITAAHRKSFFWLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSEGYGVICDFNLGD--
1em8A           ----------------------------------------------------------------------
1qhdA1          ---------NFDNSSEYIENWNLQNRRQRTSVLADASETMLANVTS-VRQEYAIPVGPVFPPGMNW----
1ni3A1          -------------------VQWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLG------NPANYPYATI
1v47A1          ----------------------------------------------------------------------
1e3mA2          -----------VLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKVEIGP
1g31A           ----------------------------------------------------------------------
1atrA1          -------------------GPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDA
1dhyA1          ----------------------------------------------------------------------
1ii8.1          -----------------------------------------------------LARTERERVKKEIKDLE
1g8yA           -THKPINILAFAAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLLQLAAQIAGGPDLLEVGELPTGPVIY
2fggA1          ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1yj5A2          -------------------------PNPEVVVAVGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVS
2gujA1          ------------------------------------VKKGSDPYFTLQAVLDDQSSGRVTLYDVNFD---
1w1wA           -GLELSNFKSYRGVT------KVGFGESNFTSIIGPNGSGKSNMMDAISFV-LGVLKDLIYRGPQSAYVK
1i1qA           --DRYSYVMHLVSVGELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGS------------
3cddA2          IVLKAGGKIYQGGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQ---GQACTVDIGGERVITGYV
1gm5A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1mi8A           --VSIKDLLDEKDFEIAINEQTMKLESAK-VSRVFMTGKKLVYILKTRLGRTIKATANHRFLTIDGWKRL
1dnpA2          ----------------------------------------------------------------------
1l7lA           -----------------KGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQG-
1d8jA           ----------------------------------------------------------------------
1esmA           ------------QAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFL
2vnuD1          --IRTRRAAELLDKRIVIWPTTHKYPLGHFVRDLGTIESAQAETEALLLEHDVEYR--------------
1iqrA2          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1mkyA1          ------------------------------VLIVGRPNVGKSTLFNKLVKDPVQDTVEWYGKTFKLVDT-
1ckeA           ---------------------------APVITIDGPSGAGKGTLCKAMAEWHLLDSGVLALAALH-HHVD
1xkpA1          ----------------------------------------------------------------------
1t9hA2          YRNIGYDVYLTSSKDQDSLADIIPHFQDKTTVFAGQSGVGKSSLLNAISPTRHVELIH--TSGGLVADTP
1q3tA           ---------------------------TIQIAIDGPASSGKSTVAKIIAKDAMYRAATYMALKNQLGVEE
1j90A           ------------------------------VLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNG
1g8fA3          -------------------------KQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKI--FEHNN
1yr6A1          ------------------------------VVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDT-GVKE
2je6I3          -------------------GIVIDIMPVKVPRVIGKNKSMYETLTS--KSIFVANNGRIWAFS------E
1iioA           ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1puoA2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1tueA           --LRYQQIE-FITFLGALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHFWLEP
1e2hA           -------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPE--PMTYWRVLGAS
1ovmA2          --IDSPDICWVGCANEASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPGTA--
1odfA           ----------------------------------GPQGSGKSFTSIQIHLMEKYGGEKSIGYASIDDFYL
1v37A           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1jqjA3          -------------SNEKFRGVRLYVSENQLKITANNPEQEE-----------AEEILDVTYSGAEMEIGF
1l1oA           ----------MDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGK--MFILSDGEGKNGTIELMEPLDEE
1b77A2          -----------------VASVITEIKAEDLQQLL-----RVSRGLQIDTIAITNKDGKIVINGYNKVE--
1wz8A1          ----------------------------------------------------------------------
1iw0A           ----------------------------------------------------------------------
1nrjB           ------------------------------IIIAGPQNSGKTSLLTLLTTDSVRPTVVSQEPLSAADYDG
1lnzA2          -----------------------------DVGLVGFPSVGKSTLLSVV----------------------
1p5zB           ---------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQS
1a2kC           ------------------------------LVLVGDGGTGKTTFVKRH----------------------


                         .         .         *         .         .         .         .:140
query           TPSDKAIRELRQNVGMVFQQYNLWPHLTVVQNLIEAPCRVLGLTKDQXXXXXXXXXXXXXXXPYSDRYPL
1b0uA           DKDGQLKVADKNQLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDEAQGKYPV
1sgwA           ------ITKVKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEIMDALESVEVL----DLKKKLG
1e69A           PVRLKDIRDRFAGTGLGVDFYSIVGIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLS
1q3hA           ----------RVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGV
1ji0A           ITNKPAHVINRXGIALVPEGRRIFPELTVYENLXXGAYNRKDKEGIKRDLEWIFSLFPRLKERL-KQLGG
1l7vC           -PLEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQH-----DKTRTELLNDVAGALALDDKLGRSTN
1m3eA1          LGLLLQSKQIKRXISSYVGENAEFERQYLAGELELTPQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGS
1n25A           GQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPK
1ex6A           ---RTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIE-WAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQG
2yyeA2          NLMLSLDATACTDVTGFGLLGHA-WNICKNSN-IGARIFFEKVPYYQLSENLVKKKIYPKGAILNFVKNY
1nijA1          ------DQLIGDRATQIKTLTNGCICCSRSNELEDALLDLLDNLDKGNIQFDRLVIEC-----TGMADPG
1e9rA           -PNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIR-NDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRE
1khbA1          ------QGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTFTNVAETSDGGVYWEGIDEPLASGVTIT
1s9hA           CV--------DKMVIWWEEGKMTAKVVESAKAILGSKVRVDQKCKSSAQIDPTPVIV------TSNTNMC
1pf4A1          YKLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGT
1t06A           --AEELYATGNYDAMYFAGIIADPKAMSESDFDRWIDGAYFYMLSDYVVAVTLSESNIAQDVADK---WI
1mukA           VSVGPMLQSTRKYFAQTLFMAKTVSGLDVNAIDALLRLRTLGADKKALTAQLLMVGLQES---EADALAG
1bmfA3          YVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLS
1ohcA1          LCFAILYSRPKSASNVHYFSDNELEYENFYADFGP---LNLAMVYRYCCKINKKLKSITMLR---KKIVH
1jalA1          ----DPRLDALAEIVKPERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENIDPL
1urjA           IAEPFNANHRSIGEKFTYPLPFFNRPLNRLLFEAAVALRSRNVARAAAHLAFDENHEGAALPADITFTAF
1rkbA           ---EQLYDGYDEEYDCPILDEDRVVDELDNQMIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYN
1jjvA           DSPL------LSKIVEHFGAQILNRAALRERVFNHDEDKLWLNNLLHPA--------------IRERMKQ
1pv4A3          RPEEVTEXQRLVKGEVVASTFDEPASRHV--QVAEXVIEKAKRLVEHKKD-------------VIILLDS
2gx8A1          IPASLQRKVIKAMVTAHPYEEVAYDVYPLDNKGETLGLG----KIGYLQEEMTLGQFAEHVKQSLDVKGA
1ffhA2          AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLE------------------------ARDLILV
1qhlA           ----SMLDTINSRVGVRLQQAGRDRKVDIKPFAIQ-GLPMSVQPTQLVTETLNERQARVLPLNELKDKLE
1zp6A1          ----------GRIDPWLPQSHQQNRXIXQIAARYAKEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTT
1e6cA           GMTVADVVAAEGWPGFRRRESEALQAVATPNRVVATGGRQFMRAHGTVVYLFAPAEELALRLQASLQAHQ
2axpA1          ----SGNEKLFEHFNKLADEDNVIIDRFVYSNLVRQLRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGDE
1f46A           ----ELLLNSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFQVPSYG
1tljA           EMPWDRKNSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAKNIETGWDILKIAREAGFKHS
1bgxT2          -------------HHLAYRTFHALKGLTTSRGAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGG
1xbtA1          KDTRALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFC----------EAMANAGKTVIVAALDGTFQR
1cr0A           EES---VEETAEDLIGLHNRVRLRQSDSLKREIIENGDQWFDELFG---------------NDTFHLYDS
2gk3A1          --------------KVLFIGESWHIHXIHSKGYDSFTSSKYEEGATWLLECLRKGGVDIDYXPAHTVFPE
1bs2A1          --------------------------------------------------------------PYLQYAHS
2iqhA1          TM----VMELIRMIKRGINRRTRIAYERMCNIKGKFQTAAQRTMVDQVRESRNPGNAEFEDLIFLARSAL
1c4oA1          ILAAQLAAEFRELFPENAVEYFISYYDYYQPEVPGKDLYIEKDASINPEIERLRHSTTRSLLTRRDVIVV
1zs3A1          MIDEKYAKELD--KAEIDHHKPTAGAMLVLSNLFIENIRLAGIYAKSPVKCEYLREIAQREVEYFFK-IS
1f2t.1          SAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGK------------------ERPLT
1mjgM           IPEGSKLP-----LGILVDIYGRKMQADFEGVLERRIHDFI---NYGEGLWHTGQRNINWLRVSKDAVAK
1vplA           NVVEEPHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFY--ASSSSEIEEMVERATEIAGLGEKIKDRVS
1j1zA2          ----------SMDANLLHISYEGGVLEDPWAEPP------KGMFRMTQDPEEAPDAPEYVEVEFFEGDPV
1ak2A1          SELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFL---LDGFPRTVRQAEMLDDLMEKRKEKLDS
2vgmA3          -----------------------------------------------------------------DEFLL
1kgdA           ENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQ-------------GLIAILDVEP
1cd5A           KIDGHIAFNEPASSLASRTRIKTLTHDTRFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQA
2f9hA1          ------VTEIGKHAIDDSEKXIILFGETATDT-LKQHAVIQSFPEKDQVTLAEGDHLKIGDTNYTITKVG
1poiA           DMLIGNGRVKAYINCYTANSGVTNVSRRFRKWFEAGKLTMEDYSQDVIYMMWHAAALGLPFLPVTLDEWG
1afrA           LDGVRDETGASPTSWAIWTRAWTAEENRHGDLL-NKYLYLSGRVDMRQIEKTIQYLIGSGMDPRTENSP-
1viaA           EQKVSEIFEQKRENFFREQEQKXADFFSSCEKACIATNLEKAGFCIYLKADFEYLKKRLDKDEISKRPLF
1udwA           EQKAK-----ALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVS-----------HSRKEETV
1l3aA           -------PRSPEFSPLDSGAFKLSREGMVMLQFAPAAGVRYDWSRKQVFSLSVTEIGSIISLGDSCEFFH
1d6jA           RFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFISPYRKDR--------------DTARQLHE
2v3jA1          ---EARPDITHQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLXVQLLHKLSIRS
1g6oA           EDTEEIVFKHHKNYTQLFFGGNITSADCLKSCLRXRPDR-----IILGELRSSEAYDFYNVLCSGHKGTL
2qgmA1          -----------------------------------------------------------------NPLKT
1t3wA           -----------NKLPGLGLFRELVNTCLSQPGLTT--GQLLEHYRGTNNAATLEKLSXWDDIADKNIAEQ
1oa8A           -------------------LPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERAVI
1mm8A           -----ALHRAADWAKSVFSSAALGDPRRTAAQLAKYSGKSITISSEGSKAAQEGAYRFIRNPNV--SAEA
1ckvA           GKIEVDCDEISELLGRQFNVYDFLVDVSS-----------------------------------------
1jbkA           MGALVA----GAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNMLKPALARGELHCVGA
1grqA           ---EAMPLKMQSAEGGIEFDADGGVS-IGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWR
3cddA1          ---------------------------------------------------------------WRQRFSK
1tmkA           LINEYLTDDSFQLSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDR-----------YVYSGVAYSAAK
1jb1A           IV---------GAAPPILSHLLEIRGLGIIDVXNLFGAGAVR-EDTTISLIVHLENWTPDQLIFDVPVPV
1lw7A2          LGG----DEQAMQYSDYPQXALGHQRYID-YAVRHSHKIAFIDTDF-----------------ITTQAFC
1g6hA           ITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLNSLFYKKWIPKEEEMVEKAFKILEFLKLSHLYDRKAG
1np6A           LRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTS---------------------KLDLILVE
1es6A2          ----------------------LRPGISFHPKLLLPNKNSADLTSPEKIQAIMTSLQDFKIVP--IDPTK
2pa7A1          --------------------------------------------------------------KKLEQVLV
2ancF1          VFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVMAQAVAEMSHYAEYDYLIVNDDF
1fl9A           ----------YNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSEKGQGILPEADILVNIDYYDDARNI
1bccF           --SRWLEGIRKWYYNAAFNKYGLMRDDTIYENDDVKEAI-RRLPENLYDDRMFRIKRALDLNMRQQILP-
1o7d.2          ----------------------------------------------------------------ERFQVI
2gtlM1          --DDHADCKIVPSSLFVCAHFNAQRY--------------------------------------------
1em8A           ----------------------------------------------------------------------
1qhdA1          ----TDLITNYSPSREDNLQRVF-TVASIRSMLV------------------------------------
1ni3A1          DPEEAKVAVPDERFDWLCEAYKPKSRVPAFLTVFDIAGLTKGASTGVGLGNAFLSHVRAVDAIY--QVVR
1v47A1          ----------------------------------------------------------------------
1e3mA2          IDRIFTRVGFXVEXTETANILHNATEYSLVLXDEIGRGTSTYDGLSL------AWACAENLANKIKALTL
1g31A           ----------------------------------------------------------------------
1atrA1          AKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPA
1dhyA1          -----------------------------------------------------------------TKSVG
1ii8.1          KAKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWLTFLSGGE
1g8yA           LPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLI----QPLIG------------------SLPNIMAP
2fggA1          -----------------------------------------------------------------TRAKA
1sbxA           ------------------------------------------------------------------FXPS
1yj5A2          SCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVPCRC---FNFCATIEQARHNNRFREXTDPSHAPV
2gujA1          ---SAKIASLDEEVPFTFEDFDVPEKL-------------------------------------------
1w1wA           AFYQKGNKLVELMRIISRNGDTSYKNFLVFQGDVEQIAATFDYVSDHLDAIYRELTGNASLTKYHATPPL
1i1qA           ---------YGGAVGYFTAHGDLDTCIVIRSALVENG-IATVQAGAGIVLDSVPQSEADET--------R
3cddA2          DDWVPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRI
1gm5A1          --------------------SSLFLWGEALPTLLEEF-LNEVEKMLKNQVNTRRIHQLLKELDDPLLENK
1yvuA2          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1mi8A           -------DELSLKEHIALPRKSDISWDSIVSITETGVEEVFDLTVPG-----------------------
1dnpA2          --------------------VWFRQDLRLHDNLALAAACRNSSARV------------LALYIATPRQWA
1l7lA           ------LICHDAFCGALVMKIGNSGTIPVNTGLFRWV----APNNVQGAITLIYNDVPGTYGNNSGSFSV
1d8jA           -----------------------------------------------------------------LDETQ
1esmA           HPNQVLKERGLXKKKGFPESYDXHRLVKFVSDLKSGVPN---------------------------VTAP
2vnuD1          ----------------------------------------------------------------------
1iqrA2          -----------------------------------------------------------------VLDPN
1xl3C1          ----------------------YDLSEFMGDIVALVDXRWAGANAFSLPTPEIXVRFYQDLXRMFRLFPL
1vhhA           -----------------------------------------------------------------RYEGK
1mkyA1          ---CGVFDNPQDIISQKXKEVTLNXIREADLVLFVVDGKR---GITKEDESLADFLRKSTVDTILVANKA
1ckeA           VASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGE-----IRTQEVANAASQVAAFPRVREALLRRQR
1xkpA1          ----------------------------------------------------------------------
1t9hA2          GFSSLEFTDIEEELGYTFPDIREKSSSCKFRGCLEPKCAVKQAVED------------GELKQYRYDHYV
1q3tA           V---EALLALLDQHPISFGRSETGDQLVFVGDVDIT----HPIRENEVTNHVSAIAAIPEVREKLVSLQQ
1j90A           VNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTL
1g8fA3          KTELLSLIQDFIGSGSGLIIPDQWED--------------------------------------------
1yr6A1          LPYEPSIDVREFVTVEEIMREGYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTPGQMETFLF
2je6I3          EILIEAIRKIENESHI------------------------------------------------------
1iioA           -------------------------------------------------------------------GDV
1e6vC           -------------------------------------------------------------------ENR
1puoA2          -PIFYDVFFAVANGNELLLDLSLKVNATEPER-TAMKKIQDCYVENG-----------------------
1uouA3          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1tueA           LTDTK---------VAMLDDATTTCWTYFDTYM-------------------------------------
1e2hA           ETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPAVLAPHIGGEAGSPPPALTLIFDRHPIAALAAR
1ovmA2          ------AQQRGELLHHTLGDGEFRHFYHMSEPITVAQ---------------------------------
1odfA           THEDQLKLNEQFKNNKLLQGR--GLPGTHDMKLLQEVLNTIFNQDTVVLP----------------KYDK
1v37A           -----------------------------------------------------------------YPELR
1zbsA1          -----------------------------------------------------------------GDEGS
1dwmA           ----------------------------------------------------------------------
1jqjA2          ---------------------------------------------------------------------L
1jqjA3          NVSYV-----LDVLNALKCENVRM-MLTDSVSS-------------------------------------
1l1oA           ------ISGIVEVVGRVTAKATIL-CTSYVQFKEDSH---------------------------------
1b77A2          ---DSGLTRPKYSLTLTDYDGSNNFNFVINMANMKIQPGNYKVMLWG-----------------------
1wz8A1          ----------------------------------------------------------------EARYPG
1iw0A           ------------------------------------------------------------------RYLG
1nrjB           SGVTLVDFPGHVKLRYKLSDYLKTRA--------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1p5zB           TNGGNVLQMMPERWSFTFQTYACLSRIRAQLASLNGKL--------------------------------
1a2kC           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIHELAETNITQVIVTHEVEVARKTASR
1b0uA           HLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSH
1sgwA           ELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILEKGIVIISSREELSY----CDV
1e69A           LLSGGEKALVGLALLFALMEIFYVLDEVDSPLDDYNAERFKRLLKENSK-HTQFIVITHNKIVMEA-ADL
1q3hA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKME-HLRKADK
1ji0A           TLSGGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHY
1l7vC           QLSGGEWQRVRLAAVVLQAGQLLLLDEPXNSLDVAQQSALDKILSALCQQGLAIVXSSHDLNHTLRHAHR
1m3eA1          PIKYNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKADQ-AGNVTFRKSARNFNLPXCKAAE
1n25A           TLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLMLIWYRPVAEFAQSIQSRIVEWKERLDKE
1ex6A           VKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAGAHDKVIVNDDLDKAYKELKD
2yyeA2          LKSNLDNWKLILLSDPVTSGGLLFTINKEKLEK------IDETAKELEVNYWIIGETIAENVLE------
1nijA1          PIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQVG---YADRILLTKTDVAGEAEKLHER
1e9rA           TAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASALTSARFVLSDKLPEHVTMPDG
1khbA1          SWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALS--WQH
1s9hA           AVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYV---------
1pf4A1          SLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDE-LQKNKTVLVIAHRLS-TIEQADE
1t06A           ASGDELKMSAGWSWLLGNRKDNAFSESKISDMLEMVKDTIHHSPRTKSAMNNFLNTVAPLHEKAVEIAKE
1mukA           KIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHL---------NTDIPPRMGWLRAI
1bmfA3          KQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAY-IPTN
1ohcA1          FTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDANFYITLLDCFHAVKKAMQ----
1jalA1          DDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKIPVLENAGMIRSVGLDKEELQAIKS
1urjA           AGGFEQRLASVMAGDAALASMAVFDEPPTDISAQDTAAARANAVGAYLARAAGLVGAMVFSTNSALHLTE
1rkbA           EKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILK-WIEQWIKDH-----------
1jjvA           KLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSAN--FEQIQRIMNSQVSQQERLKWADD
1pv4A3          ITRLARAYNTVVPAVLTGGVDANALHRPKRFFGAARNVEE-----GGSLTIIATALIDTGSKXDEVIYEE
2gx8A1          RVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMLGLNIVDPGHNVEMKQGVQKQ
1ffhA2          DTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDKVGVTGLVLTKLDGDARGGAAL
1qhlA           AMTDYHSLMFDLLRSASDRSKFYRLIEASGGISSAITRSLRDYL--LPE---------------------
1zp6A1          AAEAIERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQA-LQSAINALQSGRFR-----
1e6cA           RPTLTGRPIAEEMEAVLREREALYQDVAHYVVDAT--QPPAAIVCELMQ---------------------
2axpA1          YIEGKIDSILELYREVXSNAGLHTYSWDTGQWSSEIAKDIIFLV--------------------------
1f46A           DELQLFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKD---------------------
1tljA           GILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLARGKQKMNLLKD----------
1bgxT2          YKAGRAPTPEDFPRQLALIKELVDLGLARLEVPGYEADDVLASLAKKAEKGYEVRILTADKDLYQLLSDR
1xbtA1          KPFGAILNLVPLAESVV-----------------------------------------------------
1cr0A           FAEAETDRLLAKLAYMGLGCDVIILDHISI---RKMIDNLMTKLKGFASTGVVLVVICHDLRALRQLSDT
2gk3A1          SIDELNRYDVIVISDIGSNTFLLQNETFYQLKIKPNALESIKEYVKXGIEAKANYKNTVLAEVLPVIXLD
1bs2A1          RLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLFKLT---HQV
2iqhA1          ILRGSVAHKSCLPACVYGSAVASGYDFEREGYSLVGIDPFRLLQNSQVY------SLIRPNENPAHKSQL
1c4oA1          ASVSAIYGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIEK------------------------
1zs3A1          DLLLDENEIVPSTTEEFLKYHKFITEDPKAKYWT-DEDLLESFIVDFQAQNMF---ITRAIKLANKLAAG
1f2t.1          FLSGGERFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKD-AADH
1mjgM           GFRFKNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKERDDRMRGLTDVLCQSFAPNH
1vplA           TYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLCDR
1j1zA2          AVNGERLSPAALL----QRLNEIGGRHGVGRVDIVENRFVGMKSRGVYEPGGTILYHARRAVESLTLDRE
1ak2A1          VIEFSIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSRGIHSAIDASQTPDVVFASILA
2vgmA3          HLNKDDEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQL
1kgdA           QALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRT-YAHYFDLTIINNEIDETIRHLEE
1cd5A           AVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL------------------
2f9hA1          SFANSNLQSIAHSTLIFADAPTDEDDVIRNGVYLTP------HQLPKITIGTTIDYL-------------
1poiA           ISKEVRKTLDKVPDDKFKYIDNPFKPEKVVAVPPQVDVAIIHAQQASPDGTVRIWGGKFQDVDIAEAAKY
1afrA           YLGFIYTSFQERATFISHGNTARQAKEHGDIKLAQICGTIA------ADEKRHETAYTKIVEKLFEIDPD
1viaA           YDEIKAKKLYNERLSKYEQKANFILNIENKNID-ELLSEIKKVI--------------------------
1udwA           TVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFE
1l3aA           DPNKGRSDEGRVRKVLKVEPL---PDGSGHFFNLSVQNKLINLDENI-----YIPVTKAEFAVLVSAFNF
1d6jA           VATPGEETGLPFVEVYVDVPVEAPYEAPANPEVHVKNDAVKQIIDYLDTKGY---LPAKK----------
2v3jA1          EEKLLKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLDDDESI--CVFVGAXARGKDNFADEYVDE
1g6oA           TTLHAGSSEEAFIRLANXIKFESLIEGFKDLID--XIVHI--NHHKQCD---------------------
2qgmA1          IEPSKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEEDWGNGLKLNEY
1t3wA           --TFTDSLNHXFDSLLELRQEELIARERTHGLSNEERLELWTLNQELA----------------------
1oa8A           QFAVGEHRAQVSVEVLVEYP-FFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLK----------
1mm8A           IRKAGAMQTVKL----AQEFPELLAIEDTTSLSYRHQVAEE-LGKLGSIQDKSRGWWVHSVLLLEATTFR
1ckvA           ----------------------------------------------------------------------
1jbkA           TTLDEYRQYIEKDAALERRFQKVFVAEPSVEDTIAI----------------------------------
1grqA           SFVGDLDVLWV-----GVRCDGAVAEGRETARGDRVAGMAAKQAYVVEGVEYDVEVDTTHKESIEC-AWA
3cddA1          FTIKAAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRSIGKXAEYTVTGWRIPQTGKLWNINTL
1tmkA           GTNGMDLDWCLQPDVGLLKPDLTLFLSTQFGDERYETVKFQEKVK--------QTFMKLLDKEIRKGDES
1jb1A           PVKVGRNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLI------------------------------
1lw7A2          IQYEGKAHPFLDSXIKEYPFDVTILLKNN-----------------------------------------
1g6hA           ELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDH
1np6A           GFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLNLALLDINDVEGLADFVVEWMQK--------
1es6A2          NIMGIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASL-------------
2pa7A1          CLNGSCRVILDDGNI----IQEITLDSPAVGLY--VGPAVWHEMHDFSSDCVMMVLASDYYDETDYIRQY
2ancF1          DTALTDLKTIIRAERLRMSRQKQRHDALISKLL-------------------------------------
1fl9A           ELIAQTNLGKNIISAF------------------------------------------------------
1bccF           --KEQWTKYEEDVPYLEPYLKEVI----------------------------------------------
1o7d.2          VYNPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLF-SALVPAVGFSIYSVSQ-MPR
2gtlM1          ----------------------------------------------------------------------
1em8A           ----------------MKNATFYLLDNDTTVDGLSAVEQLVCIAAERWRSGKRVLIACEDEKQAYRLDEA
1qhdA1          ----------------------------------------------------------------------
1ni3A1          AFDDAEIIHVEGDVDPI--RDLSIIVDELLIKDAEFVEKHLEGLRKITSRGAN------TLEXKAKKEEQ
1v47A1          -------PALEIGEDERLDL-ENLATGAFFPVKGFMTREEALSVMRLPTGEVWTIPILLQFKPRVGPGNT
1e3mA2          FATHYFELTQLPEKXEGVANVHLDALEHGDTIAFXHSVQDGAASKSYGLAVAALAGVPKEVKRARQKLRE
1g31A           ------------LPIRAVGEYVILVSEPAQAGDEEVTESGLI---IGKRVQGEVPELCVVHSVGPDVPEG
1atrA1          YFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDK-------------------------------
1dhyA1          LMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDALERMADKLRQAGVAFTRGDEAL--MQQR
1ii8.1          RIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKD-AADH
1g8yA           EWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAADTGCSIVFLHHAVLVDNIRWQSY
2fggA1          RLSWAGRQXVGVGLARLD-----PADEPVAQIGDE-----LAIARALSDLANQLFALTSSDIEA------
1sbxA           DRSTERCETETISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCD--ELHIYCSRCTADQLEILKVXGI
1yj5A2          SDXVXFSYRKQFEPPTLAEGFLEILEIPFRLQEH-LDPALQRLYRQFSE---------------------
2gujA1          ----------------------------------------------------------------------
1w1wA           KLSGGEKTVAALALLFAINSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEK----
1i1qA           NKARAVLRAIATAH--------------------------------------------------------
3cddA2          QIEQGETPHELLARLAK-QRGVLLTSDTFGNLVI------------------------------------
1gm5A1          DLEEKLQAFLDYVKEIPN------LPEARKRYRIQKSLEMIEKLRSWFLIDY------------------
1yvuA2          RITRDGKTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAIGDV--------FSLL-EKLGFKKGSK
1f8xA           -FTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNGIKTNDI
1mi8A           ----------------------------------------------------------------------
1dnpA2          THNMSPRQAELINAQLNGLQIALEKGIPLLFREVDDFVASVEIVKQVCAESVTHLFYNYQYEVNERARDV
1l7lA           NIGKDQ----------------------------------------------------------------
1d8jA           HLDIGLKQKQWLMEALVNNPKIEVIDGKYAFKPKY-----------------------------------
1esmA           VYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINR
2vnuD1          ----------------------------------------------------------------------
1iqrA2          NLKTTPRRRAWFLENVRA------LREAYRARGGALWVLEGLPWEKARRLKAKAVYALTSHTPYGRYRDG
1xl3C1          GVFSDEEQRQNLLQMCQNAIDMAIESE-------------------------------------------
1vhhA           ITRNSERFKELTP---NYNPDIIFKDEENTGADRLMTQRCKDKLNAVMNQWPGVKLRVTEGWDEDGHHSE
1mkyA1          ENLREFEREVKPELYSLGFGEPI----PVSAEHNI-----------------------------------
1ckeA           AFRELPGL---IADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFLLAEIKLVPAADAL
1xkpA1          ----------QFXMLCGLRDALXGRPELAH-LSHLVEQALVSM---AEEQGETIVLGARITPEAYRESQS
1t9hA2          EFMTEIKDR-------------------------------------------------------------
1q3tA           EI-AQQGGIVDIGTVVLPQAELKIF------LVASVDERAERRYKENIAKGIE---TDLE-TLKKEIAAR
1j90A           -----EEWYKFIEESIHVQADLIIY---------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1yr6A1          HEFGVRLMENLPYPLVVYISDPEILKKPNDYCFVRFFALLIDLRLGATTIPALNLLSEEEKERHRKYFED
2je6I3          ----------------------------------------------------------------------
1iioA           ELKASDAGQVLTADDFPFSAEEVADTIVNKA---------------------------------------
1e6vC           RKYMNPNYELKKLREIPDEDIVRLMGHREPGEEYPSVHPPLEEMEE-PECPIRELVEPTEGAKAGDRIRY
1puoA2          ----------------------------------------------------------------------
1uouA3          ---------------------------------REQEELLAPADGTVLVRALPLALVLHELGALRLGVGA
1a4iA2          -------------------PAEILNGKE---ISAQIRARLKNQVTQLKEVPGFTPRLAILQVGNRDDSNL
1tueA           ----------------------------------------------------------------------
1e2hA           YLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGER-LDLAMLAAIRRVYGLLANT
1ovmA2          ----------------------------------------------------------------------
1odfA           SQFKGEGDRCPTGQKIKLPVDIFILEGWFLGFNPIL----------------------------------
1v37A           EIHFGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRLEGLKAPAVLFTHG-GVVRAVLRA
1zbsA1          GAVLGRLFIGSLLKGQXPEG---LCEAFLQEYGLTSADIIESVYRKPFPN--RFLAGFSPFIAQHLDIPA
1dwmA           --------------------------------------MAAATVERENRNVHAIVLKEGSAMTKDFRCDR
1jqjA2          RTVATDGHRLAVCSMPLPSHSVIVVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTS-----------
1jqjA3          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1wz8A1          LAFAWPRPGVLE---------ITFRGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLLRG----------
1iw0A           DLSGGQVIARMMQRHYGVDPEALGF---------------------------------------------
1nrjB           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VIYMENGHIVEHGDAGCFAHPQTEAFKNYLSH
1b0uA           VIFLHQGKIEEEGDEQVFGNPQSPRLQQFLK-
1sgwA           NENLHKY-------------------------
1e69A           LVTMVNGSAIVPVE------------------
1q3hA           ILILHQGSSYFYGTFSELQSLRPDFSSKLMGY
1ji0A           GYVLETGQIVLEGKA-----------------
1l7vC           AWLLKGGKXLASG-------------------
1m3eA1          TTVVEVEEIVDIG-------------------
1n25A           FSLSVYQKMKF---------------------
1ex6A           FIFAE---------------------------
2yyeA2          --------------------------------
1nijA1          LARINARAPVYTVTHNTNGFMLEENV------
1e9rA           DFSIRSWLEDPNGGNLFI--------------
1khbA1          GVFVGAAMRSEAKIIMHDPF------------
1s9hA           --------------------------------
1pf4A1          ILVVDEGEIIERG-------------------
1t06A           VGIVEVKRDNKKS-------------------
1mukA           LRFLGAGMVMTAT-------------------
1bmfA3          VISITDGQIFLETEFYKGIRPAINVGLSV---
1ohcA1          --------------------------------
1jalA1          YNFLTLKPTMYIAN------------------
1urjA           VDDAGPAHSKPSFYRFFLVPGTHVAANPQVDR
1rkbA           --------------------------------
1jjvA           VINNDAELAQNLPHQQKVLELHQFYLQQAENK
1pv4A3          FKGTGNXELHLSRK------------------
2gx8A1          LQEKVDAKKLNVHASQLHTDPFI---------
1ffhA2          SARVTGKPIYFAGL------------------
1qhlA           --------------------------------
1zp6A1          --------------------------------
1e6cA           --------------------------------
2axpA1          --------------------------------
1f46A           --------------------------------
1tljA           --------------------------------
1bgxT2          IHVLHPEGYLITPAW-----------------
1xbtA1          --------------------------------
1cr0A           IIALERNQLVLTGDTGIAGY------------
2gk3A1          GDDRVEKPEGICAEAVSPEHPVVNGFSDY---
1bs2A1          SSCYDVLWVAGQTELATARLALYGAARQVLY-
2iqhA1          VWMACHSAAFEDLR------------------
1c4oA1          --------------------------------
1zs3A1          VVELYGYN------------------------
1f2t.1          VISLENG-------------------------
1mjgM           VCIVTPERVGLCG-------------------
1vplA           IALIHNGTIVETGTVELKERYKAQNIEEVFE-
1j1zA2          VLHQRDMLSPKYAE------------------
1ak2A1          AF------------------------------
2vgmA3          T-------------------------------
1kgdA           AV------------------------------
1cd5A           --------------------------------
2f9hA1          --------------------------------
1poiA           TI------------------------------
1afrA           GTVLAFADMMRKK-------------------
1viaA           --------------------------------
1udwA           EFCLPTKKYADVI-------------------
1l3aA           VMPYLLGWHT----------------------
1d6jA           --------------------------------
2v3jA1          KVGL--SNYPLSAS------------------
1g6oA           --------------------------------
2qgmA1          IQTGKGNPREFLK-------------------
1t3wA           --------------------------------
1oa8A           --------------------------------
1mm8A           TVGLLHQEWWMRPDPADADEKESG--------
1ckvA           --------------------------------
1jbkA           --------------------------------
1grqA           IA------------------------------
3cddA1          VPVIDEIXGLDEE-------------------
1tmkA           ITIVDVTNKGIQEVEALIWQIVEPVLSTHIDH
1jb1A           --------------------------------
1lw7A2          --------------------------------
1g6hA           LYVMFNGQIIAEGRG-------EEEIKNVLSD
1np6A           --------------------------------
1es6A2          --------------------------------
2pa7A1          DNFKKYIAKI----------------------
2ancF1          --------------------------------
1fl9A           --------------------------------
1bccF           --------------------------------
1o7d.2          DLVIQNEYFDPNT-------------------
2gtlM1          --------------------------------
1em8A           LWARPAESFVPHNLAG----------------
1qhdA1          --------------------------------
1ni3A1          AIIEKVYQYLTETKQPIRKGDWSNREVEIINS
1v47A1          VALLHGGERVALLH------------------
1e3mA2          --------------------------------
1g31A           FCEVGDLTSLPVGQINVPHPFVALGLK-----
1atrA1          --------------------------------
1dhyA1          KVMGLLCLQDPFGLPLIYYGPAEIFHEPFLP-
1ii8.1          VIRISLENGSSKVE------------------
1g8yA           LSSMTSAEAEEWGV------------------
2fggA1          --------------------------------
1sbxA           LPFAPSCGLITKTDA-----------------
1yj5A2          --------------------------------
2gujA1          --------------------------------
1w1wA           --------------------------------
1i1qA           --------------------------------
3cddA2          --------------------------------
1gm5A1          --------------------------------
1yvuA2          IVVHRDGRLYRD--------------------
1f8xA           MLGVYIPDEEDV--------------------
1mi8A           --------------------------------
1dnpA2          EVERALRNVVCEGFDSVILPPGAV--------
1l7lA           --------------------------------
1d8jA           --------------------------------
1esmA           FLKFREGAFTDPDSYFNYAKLTKEEAIKTAXT
2vnuD1          --------------------------------
1iqrA2          RVRE----------------------------
1xl3C1          --------------------------------
1vhhA           ESLHYEGRAVDITT------------------
1mkyA1          --------------------------------
1ckeA           VLDSTTLSIEQ---------------------
1xkpA1          GVNPLQPLRDTYRD------------------
1t9hA2          --------------------------------
1q3tA           DYKDSH--------------------------
1j90A           --------------------------------
1g8fA3          --------------------------------
1yr6A1          IDYLTARLKLDPSMQGLMAYKMCSMMTEV---
2je6I3          --------------------------------
1iioA           --------------------------------
1e6vC           IQFTDSVYFAPIHPYIRARMYMWR--------
1puoA2          --------------------------------
1uouA3          ELLVDVGQRLRRGTPHRDGPALSGPQSRALQE
1a4iA2          YINVKLKAAEEIGIATHIKLPR----------
1tueA           --------------------------------
1e2hA           VRYLQCGGSWRED-------------------
1ovmA2          --------------------------------
1odfA           --------------------------------
1v37A           LGEDGLVPPGS---------------------
1zbsA1          VYSLVQNSFDDFLVRNVLRYNRPDLPLHFI--
1dwmA           VWVIVNDHGVVTS-------------------
1jqjA2          --------------------------------
1jqjA3          --------------------------------
1l1oA           --------------------------------
1b77A2          --------------------------------
1wz8A1          --------------------------------
1iw0A           --------------------------------
1nrjB           --------------------------------
1lnzA2          --------------------------------
1p5zB           --------------------------------
1a2kC           --------------------------------