[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF67908.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1z05A2.bssp"
#ERROR : Can't open dsspfile "2aa4A2.bssp"
#ERROR : Can't open dsspfile "2hoeA2.bssp"
#ERROR : Can't open dsspfile "2ap1A1.bssp"
#ERROR : Can't open dsspfile "1xc3A2.bssp"
#ERROR : Can't open dsspfile "2gupA2.bssp"
#ERROR : Can't open dsspfile "1sz2A1.bssp"
#ERROR : Can't open dsspfile "1g99A2.bssp"
#ERROR : Can't open dsspfile "1sazA2.bssp"
#ERROR : Can't open dsspfile "2ewsA1.bssp"
#ERROR : Can't open dsspfile "1woqA1.bssp"
#ERROR : Can't open dsspfile "2ch5A1.bssp"
#ERROR : Can't open dsspfile "1z05A3.bssp"
#ERROR : Can't open dsspfile "1woqA2.bssp"
#ERROR : Can't open dsspfile "1q18A2.bssp"
#ERROR : Can't open dsspfile "2aa4A1.bssp"
#ERROR : Can't open dsspfile "2ap1A2.bssp"
#ERROR : Can't open dsspfile "2i7nA2.bssp"
#ERROR : Can't open dsspfile "2hoeA3.bssp"
#ERROR : Can't open dsspfile "2gupA1.bssp"
#ERROR : Can't open dsspfile "1xc3A1.bssp"
#ERROR : Can't open dsspfile "1zc6A2.bssp"
#ERROR : Can't open dsspfile "1nmnA.bssp"
#ERROR : Can't open dsspfile "2gtdA1.bssp"
#ERROR : Can't open dsspfile "1on1A1.bssp"
#ERROR : Can't open dsspfile "1z05A1.bssp"

## Summary of PDB Search
:406
    9e-29  41%  1z05A2 [c.55.1.10] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:209 --
    3e-24  25%  2aa4A2 [c.55.1.10] PUTATIVE N-ACETYLMANNOSAMINE KINASE A:120 -- 289
    7e-22  26%  2hoeA2 [c.55.1.10] N-ACETYLGLUCOSAMINE KINASE A:200 -- 368
    1e-21  25%  2ap1A1 [c.55.1.10] PUTATIVE REGULATOR PROTEIN A:118 -- 303
    2e-21  20%  1xc3A2 [c.55.1.10] PUTATIVE FRUCTOKINASE A:119 -- 294
    2e-21  19%  2gupA2 [c.55.1.10] ROK FAMILY PROTEIN A:115 -- 289
    1e-19  14%  1sz2A1 [c.55.1.7] GLUCOKINASE A:3 -- 321
    2e-18  11%  1g99A2 [c.55.1.2] ACETATE KINASE A:198 -- 398
    2e-18  10%  1sazA2 [c.55.1.2] PROBABLE BUTYRATE KINASE 2 A:173 -- 375
    1e-17   9%  2ewsA1 [c.55.1.14] PANTOTHENATE KINASE A:1 -- 267
    2e-15  24%  1woqA1 [c.55.1.10] INORGANIC POLYPHOSPHATE/ATP-GLUCOMANNOKINASE
    8e-12  18%  2ch5A1 [c.55.1.5] NAGK PROTEIN A:118 -- 344
    3e-11  36%  1z05A3 [c.55.1.10] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:81 --
    4e-10  27%  1woqA2 [c.55.1.10] INORGANIC POLYPHOSPHATE/ATP-GLUCOMANNOKINASE
    1e-07  11%  1q18A2 [c.55.1.7] GLUCOKINASE A:112 -- 321
    1e-07  19%  2aa4A1 [c.55.1.10] PUTATIVE N-ACETYLMANNOSAMINE KINASE A:1 -- 119
    1e-07  19%  2ap1A2 [c.55.1.10] PUTATIVE REGULATOR PROTEIN A:1 -- 117
    5e-07  11%  2i7nA2 [c.55.1.14] PANTOTHENATE KINASE 1 A:382 -- 593
    9e-07  21%  2hoeA3 [c.55.1.10] N-ACETYLGLUCOSAMINE KINASE A:72 -- 199
    1e-06  24%  2gupA1 [c.55.1.10] ROK FAMILY PROTEIN A:1 -- 114
    3e-06  15%  1xc3A1 [c.55.1.10] PUTATIVE FRUCTOKINASE A:1 -- 118
    3e-06  17%  1zc6A2 [c.55.1.5] PROBABLE N-ACETYLGLUCOSAMINE KINASE A:122 -- 292
    3e-05  13%  1nmnA  [c.55.3.8] HYPOTHETICAL PROTEIN YQGF
    5e-05  12%  2gtdA1 [c.55.1.13] TYPE III PANTOTHENATE KINASE A:4 -- 121
    5e-05  24%  1on1A1 [a.4.5.24] TRANSCRIPTIONAL REGULATOR MNTR A:2 -- 62
    5e-04  69%  1z05A1 [a.4.5.63] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:10 --
:406

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxDQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEIKEAGS
1z05A2          ----------------------------------------------------------------------
2aa4A2          ----------------------------------------------------------------------
2hoeA2          ----------------------------------------------------------------------
2ap1A1          ----------------------------------------------------------------------
1xc3A2          ----------------------------------------------------------------------
2gupA2          ----------------------------------------------------------------------
1sz2A1          ----------------------------------------------------------------------
1g99A2          ----------------------------------------------------------------------
1sazA2          ----------------------------------------------------------------------
2ewsA1          ----------------------------------------------------------------------
1woqA1          ----------------------------------------------------------------------
2ch5A1          ----------------------------------------------------------------------
1z05A3          ----------------------------------------------------------------------
1woqA2          ----------------------------------------------------------------------
1q18A2          ----------------------------------------------------------------------
2aa4A1          ----------------------------------------------------------------------
2ap1A2          ----------------------------------------------------------------------
2i7nA2          ----------------------------------------------------------------------
2hoeA3          ----------------------------------------------------------------------
2gupA1          ----------------------------------------------------------------------
1xc3A1          ----------------------------------------------------------------------
1zc6A2          ----------------------------------------------------------------------
1nmnA           ----------------------------------------------------------------------
2gtdA1          ----------------------------------------------------------------------
1on1A1          -------------------QIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYL----------
1z05A1          ----------DHIKQINAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHETTVQEAIS


                         .         .         *         .         .         .         .:140
query           RGRPAVGLxxxxEAWHYLSIRISRGEIFLALRDLSSKLVVXXXXXXXXXXXXXXXXRIITHVDRFFTRHQ
1z05A2          ----------------------------------------------------------------------
2aa4A2          ----------------------------------------------------------------------
2hoeA2          ----------------------------------------------------------------------
2ap1A1          ----------------------------------------------------------------------
1xc3A2          ----------------------------------------------------------------------
2gupA2          ----------------------------------------------------------------------
1sz2A1          ----------------------------------------------------------------------
1g99A2          ----------------------------------------------------------------------
1sazA2          ----------------------------------------------------------------------
2ewsA1          ---------------------------------------------------------------------D
1woqA1          --------------------------------------------------------------------RP
2ch5A1          ----------------------------------------------------------------------
1z05A3          ------------LGWQFLSMRLGRGYLTIALHELGGEVLIDTKIDIHEIDQDDVLARLLFEIEEFFQTYA
1woqA2          ----------------------------------------------------------------------
1q18A2          ----------------------------------------------------------------------
2aa4A1          ---------------TTLAIDIGGTKLAAALIGADGQIR---DRRELPTPASQTPEALRDALSALV---S
2ap1A2          ----------------YYGFDIGGTKIALGVFDSTRRLQWEKRVPTPHTSYSA----FLDAVCELVEEAD
2i7nA2          ----------------------------------------------------------------------
2hoeA3          ------------NCAYVLGIEVTRDEIAACLIDASXNILAHEAHPLPSQSDREETLNXYRIIDRAKDXXE
2gupA1          ---------------------------------------------------------LLAWLDQRLSEQD
1xc3A1          ----------------LGGIEAGGTKFVCAVGREDGTII------DRIEFPTKMPDETIEKVIQYFSQFS
1zc6A2          ----------------------------------------------------------------------
1nmnA           ---------------------------------------------------------DWNIIERLLKEWQ
2gtdA1          ---------------------------------------------------------LFSHLHPLLGDAM
1on1A1          ----------------------------------------------------------------------
1z05A1          RGRPAVGL--------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QKLERLTSIAITLPGIIDTENGVVHRMPYYEDVKEMPLGDALERHTGVPVYIQHDISAWTMAEALFGASR
1z05A2          ----------------------------------------------------------------------
2aa4A2          ----------------------------------------------------------------------
2hoeA2          ----------------------------------------------------------------------
2ap1A1          ----------------------------------------------------------------------
1xc3A2          ----------------------------------------------------------------------
2gupA2          ----------------------------------------------------------------------
1sz2A1          ------------------------------------SIAEXKKNLGFSHLEIINDFTAVSXAIPXLKKAE
1g99A2          ----------------------------------------------------------------------
1sazA2          ----------------------------------------------------------------------
2ewsA1          NQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAENINIP--AQIFVEFDAASQGLGILLKEQGH
1woqA1          EAPAAGSPVGVTFPGIIQHGVVHSAANVDK-SWLNTDIDALLTARLGRPVEVINDADAAGLAEARYGAGA
2ch5A1          ----------------------------------------------------------------------
1z05A3          AQLDRVTSIAITLPGLVNSEQGIVLQMPHY-NVKNLALGPEIYKATGLPVFVANDTRAWALAEKLFGHSQ
1woqA2          ----------------------------------------------------------------------
1q18A2          ------------------------------------------------------------------AEPV
2aa4A1          PLQAHAQRVAIASTGIIRDGSLLALNPHNLGGLLHFPLVKTLEQLTNLPTIAINDAAAWAEFQALDG---
2ap1A2          QRFGVKGSVGIGIPGMPETEDGTLYAANVP-AASGKPLRADLSARLDRDVRLDNDANCFALSEAW-----
2i7nA2          ----------------------------------------------------------------------
2hoeA3          KLGSKLSALTVAAPGPIDTERGIIID-PRNFPLSQIPLANLLKEKYGIEVWVENDADXGAVGEKWYT---
2gupA1          -----YSGIAXSVPGAVNQETGVIDAVPYIHGF---SWYEALSS-YQLPVHLENDANCVGLSELLA----
1xc3A1          LQAIGIGSFGPVDNDKTSQTYGTITATPKA-GWRHYPFLQTVKNEMKIPVGFSTDVNAAALGEFLFGEAK
1zc6A2          ----------------------------------------------------------------------
1nmnA           PDE-----IIVGLPLNMDGTEQPLTAR-------ARKFANRIHGRFGVEVKLHDERLSTVGKVDSASAVI
2gtdA1          REIKG-----IGVASVVPTQNTVIERFSQKYFHISPI--WVKAKNGCVKWNVKNPSEVGADRVANVVAFV
1on1A1          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSVLELTQL
1z05A2          --DNSVLISIHHGLGAGIVLDGRVLQGRHGNIGELGHIQIDPQGKRCHCGNYGCLETVASSQAIRDQVTA
2aa4A2          --TDMVFITVSTGVGGGVVSGCKLLTGPGGLAGHIGHTLADPHGPVCGCGRTGCVEAIASGRGIAAAAQG
2hoeA2          -------ILTGKGIGAGIIIDGELYRGENGYAGEIGYT-------RVFNGNEVFLEDVCNENVVLKHVLS
2ap1A1          ----VMGLILGTGVGGGLVLNGKPITGQSYITGEFGHMRLPVDARRCGCGQMGCIENYLSGRGFAWLYQ-
1xc3A2          GLDSCLYITIGTGIGAGAIVEGRLLQGLSHP--EMGHIYIRRHPDDVYQGKGDCFEGLASGPAIEAR---
2gupA2          --ENAACVVIGTGIGGAXIINGRL-HRGRHGLGEFGYXTTL-----APAEKLNNWSQLASTGNXVRYVIE
1sz2A1          PVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIIGHVSAERVLSGPGLVNLYRA
1g99A2          ---KIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMG----TRCGSIDPAIVPFLMEKEGLTTREID
1sazA2          ---NLVVAHXGGGISIAAHRKGRVIDVNNALDGDGPFTPE-----RSGTLPLTQLVDLCFSGKTYEEXKK
2ewsA1          DLADYIFANVGTGTSLHYFDGQSQRRVGG---IGTGGGMIQGLG-YLLSQITDYKQLTDMAQHGNTIDLK
1woqA1          G---------------------------------------------------------------------
2ch5A1          --------------GTGSNCRLINPDGSESGCGGWGHMMGDE-GSAYWIAHQAVKIVFDSIDAMFHYFQV
1z05A3          ----------------------------------------------------------------------
1woqA2          --GTVLVITLGTGIGSAFIFDGKLVPNA-----ELGHLEIDGHDAETKASA-------------------
1q18A2          EGKPIAVYGAGTGLGVAHLVHVDKRWVSLPG--EGGHVDFAPNSEEEAIIGHVSAERVLSGPGL-----V
2aa4A1          ----------------------------------------------------------------------
2ap1A2          ----------------------------------------------------------------------
2i7nA2          ----------------------------------------------------------------------
2hoeA3          ----------------------------------------------------------------------
2gupA1          ----------------------------------------------------------------------
1xc3A1          ----------------------------------------------------------------------
1zc6A2          -------------IGEALYPDGSHREAG-----GWGYPSGDEASQLTQXALDGRHSHSPLTRAVLDFVGG
1nmnA           ILESYFE---------------------------------------------------------------
2gtdA1          K---------------------------------------------------------------------
1on1A1          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RLNQSMSSMLHGQPLTVDSLCQAAMQGDLLAKDIISGVGTHVGRILAIMVNLFNPQKILIGSPLSKAADI
1z05A2          RIQAGEPSCLAVEEISIEDICAAAADGDPLAVDVIQQLGRYLGAAIAIVINLFNPEKILIGGVINQAKSI
2aa4A2          ELAGA----------DAKTIFTRAGQGDEQAQQLIHRSARTLARLIADIKATTDCQCVVVGGSVG-LAEG
2hoeA2          X---------------GFSLAEARDSGDVRVKEYFDDIARYFSIGLLNLIHLFGISKIVIGGFFKELGEN
2ap1A1          --------HYYDQSLQAPEIIALWEQGDEQAHAHVERYLDLLAVCLGNILTIVDPDLLVIGGGLSNFTA-
1xc3A2          --------------------WGKKAADLSDIAQVWELEGYYIAQALAQYILILAPKKIILGGGVMQQKQV
2gupA2          KSGH--------TDWDGRKIYQEAAAGNILCQEAIERXNRNLAQGLLNIQYLIDPGVISLGGSIS-QNPD
1sz2A1          IVKADNRLPENL--KPKDITERALADSCTDCRRALSLFCVIXGRFGGLALNLGTFGGVFIAGGIVPRFLE
1g99A2          TLMNKKSGVVSGLSNDFRDLDEAASKGNRKAELALEIFAYKVKKFIGEYSALNGADAVVFTAGIGENSAS
1sazA2          RIVGNGGLVAYLGTSDAREVVRRIKQGDEWAKRVYRAXAYQIAKWIGKXAAVLKGEFIVLTGGLAHEKEF
2ewsA1          VRHIIPGDLTAANFGHVLHHLDADFTPSNKLAAVIGVVGEVVTTMAITVAREFKTENIVYIGSSFHNNAL
1woqA1          ----------------------------------------------------------------------
2ch5A1          PDRLGILTHLYRDFDKCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVPILCVGSVWKSWEL
1z05A3          ----------------------------------------------------------------------
1woqA2          ----------------------VARERDGLSWDEY---SVLLQRYFSHVEFLFSPELFIVGGGISKRADE
1q18A2          NLYRAIVKARLPENLKPKDITERALDSCTDCRRALSLFCVIXGRFGGLALNLGTFGGVFIAGGIVPRFLE
2aa4A1          ----------------------------------------------------------------------
2ap1A2          ----------------------------------------------------------------------
2i7nA2          ---------------MSKEKRDSISKEDL-ARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMV
2hoeA3          ----------------------------------------------------------------------
2gupA1          ----------------------------------------------------------------------
1xc3A1          ----------------------------------------------------------------------
1zc6A2          DWQAXXAWNGRATPAQFARLAPSAARVDPEADALLRQAGEDAWAIARALDPQDELPVALCGGLGQALRDW
1nmnA           ----------------------------------------------------------------------
2gtdA1          ----------------------------------------------------------------------
1on1A1          ----------------------------------------------------------------------
1z05A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LFPAIADSIRQQALPAYSRNTVVESTQFTNQGTMAGAALVKDAMYNGSLLIRLLQG
1z05A2          LYPSIEQCIREQSLPVYHQDLKLVESRFYKQATMPGAALIKQALYDGLLLMKVVEG
2aa4A2          YLALVETYLAQEPAA---FHVDLLAAHYRHDAGLLGAALL----------------
2hoeA2          FLKKIKIEVETHLLYKHSVDXSFSKVQ--EPVIAFGAA------------------
2ap1A1          ITTQLAERLPRHLLP-VARAPRIERARHGDAGGMRGAAFL----------------
1xc3A2          FVPKIMNSYLDFSELSDDISDYIVPPRLGSNAGIIGTLLAHQALQA----------
2gupA2          FIQGVKKAVEDDAYEEYTVAPVIQACTYHADANLYGALV-----------------
1sz2A1          FFKASRAAFEDKGRFKEYVHDIPVYLIVHDNPGLLGSGAHLRQTLGHIL-------
1g99A2          IRKRI-----LTGLDGIGIKIDDEKNKIRGQEIDISTPD-----------------
1sazA2          LVPWI-----TKRVSFIAPVLVFPGSNEEKALALSALRVLRGEE------------
2ewsA1          LRKVVEDYTVLRGCK-------PYYVENGAFSGAIGALY-----------------
1woqA1          --------------------------------------------------------
2ch5A1          LKEGFLLALTQGRAQNFFSSFTL--MKLRHSSALGGASLGAR--------------
1z05A3          --------------------------------------------------------
1woqA2          YLPNL--RLRTPIVPAVLRN------------------------------------
1q18A2          FFSGFRAAFEDKGRFKEYVHDIPVYLIVHDNPGLLGSGA-----------------
2aa4A1          --------------------------------------------------------
2ap1A2          --------------------------------------------------------
2i7nA2          SMKLLAYAMDFWSK----GQLKALFLEHEGYFGAVGALL-----------------
2hoeA3          --------------------------------------------------------
2gupA1          --------------------------------------------------------
1xc3A1          --------------------------------------------------------
1zc6A2          LPPGFRQRLVA---------------------------------------------
1nmnA           --------------------------------------------------------
2gtdA1          --------------------------------------------------------
1on1A1          --------------------------------------------------------
1z05A1          --------------------------------------------------------