[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF68113.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bs0A.bssp"
#ERROR : Can't open dsspfile "1fc4A.bssp"
#ERROR : Can't open dsspfile "2bwnA1.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "2gb3A1.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "1gbnA.bssp"
#ERROR : Can't open dsspfile "1iugA.bssp"
#ERROR : Can't open dsspfile "1lc5A.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "1u08A.bssp"
#ERROR : Can't open dsspfile "1jg8A.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "1h1cA.bssp"
#ERROR : Can't open dsspfile "2cfbA1.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "1c4kA2.bssp"
#ERROR : Can't open dsspfile "1pmmA.bssp"
#ERROR : Can't open dsspfile "2e7iA1.bssp"
#ERROR : Can't open dsspfile "1wytB1.bssp"
#ERROR : Can't open dsspfile "1v72A1.bssp"
#ERROR : Can't open dsspfile "1mdoA.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "1vefA1.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "1h0cA.bssp"
#ERROR : Can't open dsspfile "1sf2A.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "1m32A.bssp"
#ERROR : Can't open dsspfile "1bj4A.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "1ohvA.bssp"
#ERROR : Can't open dsspfile "3bc8A1.bssp"
#ERROR : Can't open dsspfile "1qz9A.bssp"
#ERROR : Can't open dsspfile "2fn6A1.bssp"
#ERROR : Can't open dsspfile "1vk9A.bssp"
#ERROR : Can't open dsspfile "1d7rA.bssp"
#ERROR : Can't open dsspfile "1v8dA.bssp"
#ERROR : Can't open dsspfile "1sqhA.bssp"
#ERROR : Can't open dsspfile "1aamA.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "1svvA.bssp"
#ERROR : Can't open dsspfile "1xl7A1.bssp"
#ERROR : Can't open dsspfile "1o61A.bssp"
#ERROR : Can't open dsspfile "1vp4A.bssp"
#ERROR : Can't open dsspfile "2z67A1.bssp"
#ERROR : Can't open dsspfile "2i7nA1.bssp"
#ERROR : Can't open dsspfile "1ax4A.bssp"
#ERROR : Can't open dsspfile "1elqA.bssp"
#ERROR : Can't open dsspfile "2aeuA1.bssp"
#ERROR : Can't open dsspfile "1s2bA.bssp"
#ERROR : Can't open dsspfile "1fg3A.bssp"

## Summary of PDB Search
:385
    e-142  74%  1bs0A  [c.67.1.4] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
    2e-40  29%  1fc4A  [c.67.1.4] 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE
    9e-40  23%  2bwnA1 [c.67.1.4] 5-AMINOLEVULINATE SYNTHASE A:2 -- 397
    4e-26  13%  1d2fA  [c.67.1.3] MALY PROTEIN
    4e-26  10%  2gb3A1 [c.67.1.1] ASPARTATE AMINOTRANSFERASE A:4 -- 392
    2e-25  13%  1ecxA  [c.67.1.3] AMINOTRANSFERASE
    1e-24  18%  1gbnA  [c.67.1.4] ORNITHINE AMINOTRANSFERASE
    2e-23  13%  1iugA  [c.67.1.3] PUTATIVE ASPARTATE AMINOTRANSFERASE
    5e-23  14%  1lc5A  [c.67.1.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    5e-23  11%  1cl1A  [c.67.1.3] CYSTATHIONINE BETA-LYASE
    3e-22  14%  1u08A  [c.67.1.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    3e-22  18%  1jg8A  [c.67.1.1] L-ALLO-THREONINE ALDOLASE
    1e-21  10%  1c7nA  [c.67.1.3] CYSTALYSIN
    1e-21  12%  1h1cA  [c.67.1.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-21  16%  2cfbA1 [c.67.1.4] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE A:19 --
    5e-21  12%  1b5oA  [c.67.1.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    8e-21  14%  1c4kA2 [c.67.1.5] PROTEIN (ORNITHINE DECARBOXYLASE) A:108 -- 569
    2e-20  10%  1pmmA  [c.67.1.6] GLUTAMATE DECARBOXYLASE BETA
    2e-20  17%  2e7iA1 [c.67.1.9] SEP-TRNA:CYS-TRNA SYNTHASE A:8 -- 371
    5e-20  14%  1wytB1 [c.67.1.7] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN) B:2
    1e-19  14%  1v72A1 [c.67.1.1] ALDOLASE A:6 -- 350
    7e-19  15%  1mdoA  [c.67.1.4] ARNB AMINOTRANSFERASE
    3e-18  12%  1c0nA  [c.67.1.3] PROTEIN (CSDB PROTEIN)
    4e-18  13%  1dtyA  [c.67.1.4] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    4e-18  17%  1cs1A  [c.67.1.3] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    1e-17  17%  1vefA1 [c.67.1.4] ACETYLORNITHINE/ACETYL-LYSINE AMINOTRANSFERASE
    4e-17  10%  1b8gA  [c.67.1.4] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    1e-16  15%  1b9hA  [c.67.1.4] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    1e-16  12%  1h0cA  [c.67.1.3] ALANINE--GLYOXYLATE AMINOTRANSFERASE
    4e-16  17%  1sf2A  [c.67.1.4] 4-AMINOBUTYRATE AMINOTRANSFERASE
    6e-16   9%  1bw0A  [c.67.1.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    6e-16  16%  1m32A  [c.67.1.3] 2-AMINOETHYLPHOSPHONATE-PYRUVATE
    3e-15  24%  1bj4A  [c.67.1.4] PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)
    5e-15   6%  1agxA  [c.88.1.1] GLUTAMINASE-ASPARAGINASE
    1e-14  15%  1ohvA  [c.67.1.4] 4-AMINOBUTYRATE AMINOTRANSFERASE
    4e-14   8%  3bc8A1 [c.67.1.9] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    2e-13  13%  1qz9A  [c.67.1.3] KYNURENINASE
    1e-12  16%  2fn6A1 [c.67.1.4] AMINOTRANSFERASE A:2 -- 372
    1e-11  11%  1vk9A  [c.97.1.3] CONSERVED HYPOTHETICAL PROTEIN TM1506
    1e-11  24%  1d7rA  [c.67.1.4] PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE
    2e-11  17%  1v8dA  [c.140.1.1] HYPOTHETICAL PROTEIN (TT1679)
    2e-10  10%  1sqhA  [d.108.1.5] HYPOTHETICAL PROTEIN CG14615-PA
    1e-09  11%  1aamA  [c.67.1.1] ASPARTATE AMINOTRANSFERASE
    1e-09   7%  1c8nA  [b.121.4.7] COAT PROTEIN
    1e-08  21%  1svvA  [c.67.1.1] THREONINE ALDOLASE
    1e-07  11%  1xl7A1 [c.43.1.3] PEROXISOMAL CARNITINE O-OCTANOYLTRANSFERASE A:11
    4e-07  19%  1o61A  [c.67.1.4] AMINOTRANSFERASE
    7e-07  13%  1vp4A  [c.67.1.1] AMINOTRANSFERASE, PUTATIVE
    2e-06  20%  2z67A1 [c.67.1.9] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE A:1
    2e-06  11%  2i7nA1 [c.55.1.14] PANTOTHENATE KINASE 1 A:236 -- 381
    6e-06  13%  1ax4A  [c.67.1.2] TRYPTOPHANASE
    8e-05  20%  1elqA  [c.67.1.3] L-CYSTEINE/L-CYSTINE C-S LYASE
    1e-04  21%  2aeuA1 [c.67.1.8] HYPOTHETICAL PROTEIN MJ0158 A:9 -- 374
    4e-04   9%  1s2bA  [b.29.1.20] SCYTALIDOPEPSIN B
    6e-04  19%  1fg3A  [c.67.1.1] HISTIDINOL PHOSPHATE AMINOTRANSFERASE
:385

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSWQQRVDDALTARRVTDTLRRRYVVSQGAGRWLVANGRQYLNFSSNDYLGLSQHPQIIRAWQQAATRFX
1bs0A           -SWQEKINAALDARRAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFG
1fc4A           -EFYQQLTNDLETARAEGLFKEERIITSAQQADITADGSHVINFCANNYLGLANHPDLIAAAKAGXDSHG
2bwnA1          -------HDEGRYRTFIDIEREKGAFPKAQWNRPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVG
1d2fA           -----------------------------------------LPFTISDMDFAT-APCIIEALNQRLMHGV
2gb3A1          -----------------------------------KRGVRIHHLNIGQPDLKT-PEVFFERIYENKPEVV
1ecxA           --------------------------------------RVYF-----DNNATTRDDRVLEEMIVFYREYG
1gbnA           --------------------PLPVALERGKGIYLWVEGRKYFDFLSSYSAVNQCHPKIVNALKSQVDKLT
1iugA           -----------------------------------------------DWLLTPGPVRLHPKALEALARPQ
1lc5A           ------------------------NIREPATVLG-ISPDQLLDFSANINPL-GMPVSVKRALIDNLDCIE
1cl1A           --------------------------------------YTLGAVNSVIQRASSLVFDSVEAKKHATRNRA
1u08A           --------------IPQSKLPQLGTTIFTQMSAL-AQQHQAINLSQGFPDFDG-PRYLQERLAHHVAQGA
1jg8A           ----------------------------------------------------------------------
1c7nA           -----------------------------MYSQNPEVGNEVVPLSVADM-EFKNPPELIEGLKKYLDETV
1h1cA           ------------------------LIAKRAYPYE-TEKRDKTYLALNEN-PFPFPEDLVDEVFRRLNSDA
2cfbA1          ------------------------VFDHVKGAHIWVDGNQYIDYVGSWGPAIVGHPEVIDALHAALEKGT
1b5oA           ------------------------AVNAKALELRR-QGVDLVALTAGEP-DFDTPEHVKEAARRALAQGK
1c4kA2          ----------------------------------------------------------------------
1pmmA           ---SELLDSRFGAKSISTIAESKRLHEMRDDVAFQINDELYLDGNARQNLATFCQTWDDENVHKLMDLSI
2e7iA1          ----------------------------------------------------------------------
1wytB1          -------------------------------RHYTGLSRRQVGVDTTFYPLGSCTMKYNPKLHEEAARLF
1v72A1          ----------------------------------------ALGFSSDNIAGA--SPEVAQALVKHSSGQA
1mdoA           -----------------------------------------------DFLPFS-RPAXGAEELAAVKTVL
1c0nA           -----------------------DAVRADFPVLSEVNGLPLAYLDSA-ASAQK-PSQVIDAEAEFYRHGY
1dtyA           -DDLAFDERHI-WHPYTSMTSPLPPVVSAEGCELISDGRRLVDGMSSWWAAIHGYPQLNAAMKSQIDAMS
1cs1A           ----------------------------------------------------------------------
1vefA1          -------------SGVYNKHDLLIVRGQGARVWD-AEGNEYIDCVGGYGVANLGHG---NPEVVEAVKRQ
1b8gA           ----------MLSRNATSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAEWLAKNPEAAAFKKNGESIFAEL
1b9hA           ------------------------------------------------------WPQYDDAERNGLVRAL
1h0cA           ----------------------------------------------------------------------
1sf2A           ------------------------FADRAENCRVWVEGREYLDFAGGIAVLNHLHPKVVAAVEAQLKKLS
1bw0A           -----------------------------------------LSVGDPTLDKNLLSAAQIKKLKEAIDSQE
1m32A           ----------------------------------------YLLLTP----GPLTSRTVKEAXLFDSCTWD
1bj4A           ----------------------------------------------------------------------
1agxA           ----------------------------------------------------------------------
1ohvA           ----------------------------------------------------------------------
3bc8A1          -------------RLLLEQGKCPEDGWDESTLELFLHELAVMDSNNFGNCGVGEEGRVASALVARRHYRF
1qz9A           ---------------------------------------------DGNSLGARPVAALARAQAVIAEEWG
2fn6A1          -------------------------------------------------FAYS-EPCLDKEDKKAVLEVL
1vk9A           ----------------------------------------------------------------------
1d7rA           -------DDATFWRNARQHLVRYGIIERAKGSFVYADGRAILDFTSGQMLGHC-HPEIVSVIGEYAGKLD
1v8dA           ----------------------------------------------------------------------
1sqhA           ----------------------------------------------------------------------
1aamA           -----------------------------------DERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLL
1c8nA           ----------------------------------------------------------------------
1svvA           ----------------------------------------------------------------------
1xl7A1          ----------------------------------------------------------------------
1o61A           ----------------------------------------------------------------------
1vp4A           ----------------------------------------------------------------------
2z67A1          ----------------------------------------------------------------------
2i7nA1          ----------------------------------------------------------------------
1ax4A           ----------------------------------------------------------------------
1elqA           ----------------------------------------------------------------------
2aeuA1          ----------------------------------------------------------------------
1s2bA           ----------------------------------------------------------------------
1fg3A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXVAHQALEEELAQWLGYPRALLFISGFAANQAVITALMKKNDRIVADRLSHASLLEAA
1bs0A           IGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAA
1fc4A           FGXASVRFICGTQDSHKELEQKLAAFLGXEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGV
2bwnA1          AGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIE
1d2fA           FGYSRWKNDEFLAAIAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGEGVVIHTPAYDAFYKAI
2gb3A1          YYSHSAGIWELREAFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFA
1ecxA           NPNSAHGMGIEANLHMEKAREKVAKVLGVSPSEIFFTSNWILKTVAETFEKRKRTIITTPIEHKAVLETM
1gbnA           LTSRAFYNN-----VLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKKAKIVFAAGNFWGRTLSAI
1iugA           LHHRTEAARE----VFLKARGLLREAFRTEGEVLILSGTLAMEALVKNLFAPGERVLVPVYGKFSERFYE
1lc5A           RYPDAD---------YFHLHQALARHHQVPASWILAGNGETESIFTVASGLKPRRAMIVTPGFAEYGRAL
1cl1A           NGELFYGRRGTL--THFSLQQAMCELEGGAGCVLFPCGAAAVANSILAFIEQGDHVLMTNTAYEPSQDFC
1u08A           NQYAPMTGVQALREAIAQKTERLYGYQPDADSDITVTATEALYAAITALVRNGDEVICFDPSYDSYAPAI
1jg8A           ---------------INELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEMA
1c7nA           LGYTGPTEEYKKTVK-KWMKDRHQWDIQTDWIINTAGVVPAVFNAVREFTKPGDGVIIITPVYYPFFMAI
1h1cA           LRIYYDSP-------DEELIEKILSYLDTDFLSKNNVSVGNGDEIIYVXXLXFDRSVFFPPTYSCYRIFA
2cfbA1          SFGAPCLL------ENILAEMVIAAVPSVEMVRFVNSGTEACMAVLRLMRAYTQRE------KVIKFEGC
1b5oA           TKYAPPAGIPELREAAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMV
1c4kA2          --------------PAVAAEKHAARVYNADKTYFVLGGSNANNTVTSALVSNGDLVLFDRNNHKSVYNSA
1pmmA           NKNWIDKEEYPQSAADLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMPTDKPNLVCGPVQICWHKFA
2e7iA1          ---------------HDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAA
1wytB1          ADLHPYQDPRTAQGALRLLGEYLKALTGMDAITLEPAGAHGELTGILIIRATRRVVLVPDSAHGSNPATA
1v72A1          GPYGTDE-------LTAQVKRKFCEIFERDVEVFLVPTTAANALCLSAMTPPWGNIYCHPASHINNDECG
1mdoA           DSGWITTGP-----KNQELEAAFCRLTGNQYAVAVSSATAGHIALXALGIGEGDEVITPSXTWVSTLNXI
1c0nA           AAVHAGAHTLSAQAKMENVRKRASLFINARSAEELVGINLVANSWGNSNVRAGDNIIISQMEHHANIVPW
1dtyA           HVMFGEITHAPAIELCRKLVAMTPQPLARDRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFA
1cs1A           ---------------RDVVQRALAELEGGAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLD
1vefA1          AETLMAMPQTLPTPMRGEFYRTLTAILPPELNRVFPVGTEANEAALKFARAHTGRKAAMRGFSGRTMGSL
1b8gA           ALFQDYHGLPAFKKAMVDMAEIRGNKVTFDPLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDL
1b9hA           EQGQWWRMGGD---EVNSFEREFAAHHGAAHALAVTNGTHALEALQVMGVGPGTEVIVPAFTFISSSQAA
1h0cA           --------------IMDEIKEGIQYVFQTRTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAVD
1sf2A           HTCFQVLAYE----PYLELCEIMNQKVPAKKTLLVTTGSEAVENAVKIARAATKRIAFSGAYHGRTHYTL
1bw0A           CNGYFPTVGSPEARNSFVHKEELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVC
1m32A           DDYNIG--------VVEQIRQQLTALATASSVLLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARXVI
1bj4A           -------------------------------NVQPYSGSPANFAVYTALVEPHGRIMGLDLPHGFMTDKK
1agxA           --------------SIFAARDVTKGINIHTHAFVSQWGALGTLVEGKPYWFRSSVKKHTNNSEFNIEKIQ
1ohvA           -------------------------FHGRTMGCLATTHSKAIHKIDIPSF---DWPIAPFPRLKYPLEEF
3bc8A1          IHGIGRQPKAAGSSLLNKITNSLVLNVSVASCFVVPMATGMSLTLCFLTLRHKKYIIWPRIDQKSCFKSM
1qz9A           NGLIRSWNSAGWRDLSERLGNRLATLIGARDGEVVVTDTTSIALRVQATRSPERRVIVTETSNFPTDLYI
2fn6A1          NSKQLTQGK-----RSLLFEEALCEFLGVKHALVFNSATSALLTLYRNFSADRNEIITTPISFVATANML
1vk9A           ----------------------------------------------------------------------
1d7rA           HLFSGMLSRPVVDLA-----TRLANITGLDRALLLSTGAESNEAAIRLVTGKYEIVGFAQSWHGMTGAAA
1v8dA           --------------RALVVERETARAFGKEEVAVFPHPKAGGAKATAAFLRFRDPVMVESLAHGGMDIGG
1sqhA           ----------------------------------------------------------------------
1aamA           ENETTKNYLGIDGIPEELLFGKGSALINDKRARTAQTPGGTGALRVAAKNTSVKRVWVSNPSWPNHKSVF
1c8nA           ----------------------------------------------------------------------
1svvA           ----------------AKAARLIGELLERPDADVHFGGTQTNLIACSLALRPWEAVIATQLGHISTHETG
1xl7A1          ---------------NLTLLEKIQTSLFVYSIEDSSPHAEEYSQVFEXLLGGDPSVRWGDKSYNLISFAN
1o61A           ---------------VNRFEQSVKDYSKSENALALNSATAALHLALRVAVKQDDIVLASSFTFIASVAPI
1vp4A           ---------------DPVLKQQILKLLEREDNLIFTVGSQALDLIGKLFLDDESYCVLDDPAYLGAINAF
2z67A1          ------------------------------------------------LSAARKKVIYPYASHKSPIKAV
2i7nA1          ----------------------------------------------------------------------
1ax4A           --------------NYYDLKDKAKELFNYDYIIPAHQGRGAENILFPVLLKYKQKVFISNFHFDTTAAHV
1elqA           ------------------LRQALAETFNVPNTITITDNTGCDIVLWGLDWHQGDEILLTDCEHPGIIAIV
2aeuA1          ----------------------------------------------------------------------
1s2bA           ----------------------------------------------------------------------
1fg3A           ---------------PKAVIENYAQYAGVKPEQVLVSRGAGIELLIRAFCEPKDAILYCPPTYGXYSVSA


                         +         .         .         .         .         *         .:210
query           NLSPAQLRRFIHNDTQHLSRLLQSPCVGQQLVVTEGVYSMDGDSAPLAEIQHIARRHHAWLLVDDAHGIG
1bs0A           SLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTG
1fc4A           RLCKAKRYRYANNDXQELARLKEAREAGARLIATDGVFSXDGVIANLKGVCDLADKYDALVXVDDSHAVG
2bwnA1          GIKRNAGPKRIFRHNDVAHLRELIAADAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVG
1d2fA           EGNQRTVMPVALEKQKLEAVLAKPECKIMLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDM
2gb3A1          KIAGVKLIPVTRRXEEGFAIPQNLESFINEGIVLSNPCNPTGVVYGKDYLVEIAERHGLFLIVDEVYSEI
1ecxA           KYLSMKGFKVKYVPVDSLEKLVDEDTF---LVSIMAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQT
1gbnA           SSSTDPTSYDGYNDLPALERALQDPNVA--AFMVEPIQGEAGVVVPLMGVRELCTRHQVLFIADEIQ-TG
1iugA           IALEAGLVVERLDYPYGDTPRPEDVAKEGYGLLLVHSETSTGALADLPALARAFKEKNPEGLVGADMVTS
1lc5A           AQSGCEIRRWSLREADGWQLTDAILEALTPCLFLCTPNNPTGERPLLQAIADRCKSLNINLILDEAFIDF
1cl1A           SKILSKLGVTTSWDPLIGADIVKHLQPNTKIVFLESPGSITMEVHDVPAIVAAVRSVVPDAIIMIDNTWA
1u08A           ALSGGIVKRMALQPPHFRVDWQEFAALLSELVILNTPHNPSATVWQQADFAQAIAGHEIFVISDEVYEHI
1jg8A           VLSGVMPHPVPGKDPDDVRKAINIHFPRTSLIAIENTHNRSGGRENIKEICTIAKEHGINVHIDGARIFN
1c7nA           KNQERKIIECELIDFQKLEKLSDKNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDL
1h1cA           KAVGAKFLEVPLTKDLRIPEVNVGEGDVVF---IPNPNNPTGHVFEREEIE-RILKTGAFVALDEAYYEF
2cfbA1          YHGHAATLTAPYNDLEAVSRLFEQYPNDIAGVILEPVVGNAGFIPPDAGLRELTKQYGALLVFDEVMTGF
1b5oA           RFAGGVVVEVETLPEEGFVRVRRAITPRTKALVVNSPNNPTGAVYPLEALARLAVEHDFYLVSDEIYEHL
1c4kA2          LAMAGGRPVYLQTNRNPYGFIGGIYDSDRLAVIQLGTY--DGTIYNAHEVVKRIGHLCDYIEFDSAWVIP
1pmmA           RYWDVELREIPMRPGQLPKRMIEACDENTIGVVPTFGVTYTGNYEFALDKFQADTGIDIDMHIDAASGGF
2e7iA1          ERAGLNIALVPKTDYPDYAITPEKKRGEVVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIG
1wytB1          SMAGYQVRESGPEGEVDLEALKRELGPHVAALMLTNPNTLGLFERRILEISRLCKEAGVQLYYDGANLNA
1v72A1          APEFFSNGAKLMERTREKVGDVHTTQPACVSITQATEVGSIYTLDEIEAIGDVCKSSSLGLHMDGSRANA
1mdoA           VLLGANPVXVDVDRDTLXVTPEHIEAAITPQTKAIIPVHYAGAPADLDAIYALGERYGIPVIEDAAHATG
1c0nA           QMLCARVGAELRVIPLNPDGTLQLETLPTLFLAITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVM
1dtyA           PAPQSRMDGEWDERDMVGFARLMAAHRHEIVIIEPIVQGAMYHPEWLKRIRKICDREGILLIADEIATGF
1cs1A           SLAKRGCYRVLFVDQGDEQALRAALAEKPKLVLVESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSP
1vefA1          SVTWEPKYREPFIPYNDVEALKRAVDEETAAVILEPVQGEGGVRPATPEFLRAARQEKGALLILDEIQTG
1b8gA           KWRTGVEIVPIHTALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTLYLLLSFVEDKGIHLISDEIYGTA
1b9hA           QRLGAVTVPVDVDAATYNLDPEAVAAAVTPRTKVIMPVHMAGLMADMDALAKISADTGVPLLQDAAHAHG
1h0cA           GVHPMTKDPGGHYTLQEVEEGLAQHKP--VLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLG
1sf2A           ALTGKVNPYSADDAIASIHRIFKNDAAPEDAIVIEPVQGEGGFYASSPAFMQLCDEHGIMLIADEVQGAG
1bw0A           KAYGIGMHFYENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSVEDIVRLAEELRLPLFSDEIYAGM
1m32A           AHHAYDCGEVARPDVQAIDAILN-ADPTISHIAXVHSETTTGXLNPIDEVGALAHRYGKTYIVDAXSSFG
1bj4A           KISATSIFFESMPNYDQLEENARL-FHPKLIIAGTSCYSRNLE---YARLRKIADENGAYLMADMAHISG
1agxA           GDALPGVQIVYGSDNMMPDAYQAFAKAGVKAIIHAGTGNGSMANYLVPEVRKLHDEQGLQIVRSSRVAQG
1ohvA           VKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDLRDISRKHGCAFLVDEVQTGG
3bc8A1          VTAGFEPVVIENVLEGVEAKIQELGPEHILCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQ
1qz9A           AEGLADMLQQGYTLRLVDSPEELPQAIDQDVVMLTHVNYKTGYMHDMQALTALSHECGALAIWDLAHSAG
2fn6A1          LESGYTPVFAGIKNDGNIDELALEKLINER-TKAIVSVDYAGKSVEVESVQKLCKKHSLSFLSDSSHALG
1vk9A           -----------KNLLRSALKIFEKKDLSLLAYSGRSIFSKDSGLKPVVELFKRFDNLEGSLVIDKXVGKA
1d7rA           SATYSAGRKGVGPAAVGSFAIPAPFTYRPRFFIAEPILSSGGIIELMAALKRKCEARGMLLILDEAQGVG
1v8dA           VLIGMHLRPVAVRKIGEAVLLAAKTRP-KLVGGARAVYTREEMLKKLEEF--------------------
1sqhA           ----------------------------------------------------FGIRNFHYLLLYNQRKWD
1aamA           NSAGLEVREYAYYDAENLINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQQLSVEKGWLPLFDFAYGFA
1c8nA           -------------CLSYDRNDVAPGSRVQLSQTYKAINFPPYAGYDGAAILNTDVTPTSAIYVDVDVTRF
1svvA           KLRVADIESALHNRSEHXVIISNTTEVG-------TQYTKQ----ELEDISASCKEHGLYLFLDGASALS
1xl7A1          GIFGCCCDHAPYDAXVXVAHYVDERVLETEGRWKG---SEKVRDIPLPEELVFTVDEKILNDVSQAKA--
1o61A           NIDVDLLKLAIKECEKKPKALI--------------LTHLYGNAAKMDEIVEICKENDIVLIEDAAEALG
1vp4A           RQYLANFVVVPLESEFDKNGKIKQVKFIYVVSNFHNPAGVTTSLEKRKALVEIAEKYDLF-IVEDDPYGA
2z67A1          SFVVEDIENAIKKEIELGNR----PCV----LSTLTFFP-PRNSDDIVEIAKICENYDIPHIINGAYAIQ
2i7nA1          -----------------------------------------------------------WFGMDIGGTLV
1ax4A           ELNSETYDDWKGDDIKKLKENAQHGADNIVAIVSTVTCNSAGSMSNLKEVYEIAKQHGIFVVMDSARCEN
1elqA           QAIAARFGTLNQGDAAAVLANHLGPKTR--LVILSHLLWNTGQVLPLAEIMAVCRRHPVRVLVDGAQSA-
2aeuA1          ------------------------------------------ELENFKKVINTAKNKEAIVFVDDASGAR
1s2bA           ---------------------------------TGQKVSKSFS---NESSGSLCRTNAEFIIEDFEECNS
1fg3A           ETIGVECRTVTLDNWQLDLQGISDKLDGVKVVYVCSPNNPTGQLINPQDFRTLLERGKAIVVADEAY-IE


                         .         .         .         +         .         .         .:280
query           VTGDEGRGTCWQRGVKPELLVVTFGKGFGVSGAAVLCSESVADYLLQFARHLVYSTSMXXXXXXXXXXXX
1bs0A           VIGEQGRGSCWLQKVKPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASL
1fc4A           FVGENGRGSHEYCDVXGRVDIITGTLGKALGGGYTAARKEVVEWLRQRSRPYLFSNSL--APAIVAASIK
2bwnA1          MYGPRGAGVAERDGLMHRIDIFTLAXAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASI
1d2fA           VWGEQPHIPWSNVARGDWALLTSGSKSFNIPAAYGIIENSSSRDAYLSALKGRDGLSSPSVLALTAHIAA
2gb3A1          VFRGEFASALSIESDKVVVIVSXKFSACGARVGCLITRNEELISHAXKLAQGRLAPP---LLEQIGSVGL
1ecxA           IGKIPFSLEKLEV----DYASFSAHKFHGVGITYIRKGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARA
1gbnA           LARTGRWLAVDYENVRPD--IVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTGGNPLGCRVAIAAL
1iugA           LLVGEVALEAM--GVDAAASGSQXGLMCPPGLGFVALSPRALELKAQKEGESAWTPAINLVLAVAAVLEE
1lc5A           IPHETGFIPALKDN-PHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMRRQQMPWSVNALAALAGEVAL
1cl1A           AGV-LFKALDFGIDVSIQAATXYLVGHSDAMIGTAVCNARCWEQLRENAYLMGQMVDADTAYITSRGLRT
1u08A           NFSQQGHASVLAHPQLREVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADM
1jg8A           ASIASGVPVK-EYAGYADSVMFCLSXGLCAPVGSVVVGDRDFIERARKARKML----GGGMRQAGVLAAA
1c7nA           IMPGYEHTVFQSIDEQLAITFTAPSKTFNIAGSNIIIKNPDIRERFTKSRDATSGMPF-TTLGYKACEIC
1h1cA           HGESYVDF-LKKYENLA--VIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQXFAKVALD
2cfbA1          RIA--YGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRAEIMKMVAPAGPTLSGNPLAMTAGIKTLEILS
1b5oA           LYEGEHFSPGRVAPEHTLTVNGAAKAFAGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTN
1c4kA2          MMRNSSPLLIDDLGPEDPGIIVVQSVGFSQTSQIHKKDSHIKGKHFNNSFNLFMSTSPFYPMYAALDVNA
1pmmA           LAPFVAPDIVWDFRLPRVKSISSGHKFGLAPLGCGWVDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQ
2e7iA1          RMP------VSLKEIGADFIVGSGHKSMAASGGVMGMKEEWAEIVLRRSEKYKNKEVELLGCTARGATII
1wytB1          IMGWARPGDMG-----FDVVHLNLHKTFTVPVPLVERGEEGFYLDFDRPKSIRVRSFYGNFLALVRAWAY
1v72A1          LVSLGCSPAEMTWKAGVDALSFGATKNGLAAEAIVLFNTSLATEMSYRRKRAGHLSSK---MRFLSAQID
1mdoA           TSYKGRHIGARGTAI----FSFHAIKNICAEGGIVVTDNPQFADKLRSLKFHGLGVDQAEVLAPGYKYNL
1c0nA           HHPVDV-QALDCDFYVFSGHKLYGPTGIGILYVKIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAAL
1dtyA           GTGKLFACEHAEIAP----DILCLGKALTGGTMTLSATLTTREVAETISDGEAGCFMHGPTFMGNPLACA
1cs1A           ALQNPLALGA--DLVLHSCTXYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYLLLRGLRT
1vefA1          MGRTGKRFAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMPKGGHGTTFGGNP-----LAMAAGV
1b8gA           FSSPSFISVMEVLKDRNVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAML
1b9hA           ARWQ-GKRVGELDSIATFSFQNGKLMTAGEGGAVVFPDGETEKYETAFLRHSCGRPRGSNMRLNEFSASV
1h0cA           GTPLYMDRQTSLISFSDKAKKKMYS-RKTKPFSFYLDIKWLANFWGCDDQPRMYHHTIPVISLYSLRESL
1sf2A           RTG--TLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAGNP-----IACVAAL
1bw0A           VFKGKDPNAETTVPRVILGGTAXNLVVPGWRLGWLLYVDPHGNGPSFLEGLKMLVCGPCTVVQAALGEAL
1m32A           GIPXDIAAL------HIDYLISSANKCIQGGFAFVIAREQKLAACKGHSRSLSLFTSPTHTVLAFAQALK
1bj4A           LVA-------------------------------------------------------------------
1agxA           FVLRNAEQPDDKYGWIA-AHDLNPQKARLLMATKTNDAKEIQNMFWNY----------------------
1ohvA           G-STGKFWAHEHWGLDDPADVMTFSKKMMTGGFFHKE------EFRPNAPYRIFNTWLGDPSKNLLLAE-
3bc8A1          SSKCMHLIQQGARVGRIDAFVQSLDXNFMVPVGGAIIAGFNEPFIQDISKMYPGRAASPSLDVLITLLSL
1qz9A           AVPVDLHQAGA------DYAIGCTYKYLNGGPAFVWVSPQLCDLVPQPLSGWFGHSRQPITSLAMVECGL
2fn6A1          S-----EYQNKKVGGFALASVFSFHAIKPITTAVVTNDSELHEKMKLFRSHGMLKKD-------------
1vk9A           AASFLLKXKPD--HIHAKVISKKLXNEYGQSFSYDEKIPFVLGKD-------------------------
1d7rA           RTG--TMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERA-------------------------
1v8dA           ----------------------------------------------------------------------
1sqhA           RQLSEAQI---PRNDLRKQFYTHRRGNFRTWGTYVSLHRDIVQS-----VSFFSWQPDGAAELWECLEQT
1aamA           RGLEEDAEGLRAFAAMHKELASSYSKNFNERVGACTLVAADSETVDRAFSQMIDANYSNPPAHGASVVAT
1c8nA           DKAWYSTIGTAAFAALTAFDQNCPCTVHIGSDAVAVPPGDIFF---KYVIELIEPIN-------------
1svvA           SPVNDLTLADIARLTD--XFYIGATKAGGXFGEALII---LNDALKPNARHLIKQRGALXAKGWLLGIQF
1xl7A1          ----------------------------------------------------------------------
1o61A           SF--------------------------------------------------------------------
1vp4A           LRYEGETVDPIFKIGGPERVVLTFSKVLGLRIGXVAGSKEFIRKIVQAKQSADLCSP-------------
2z67A1          ----------------------------------------------------------------------
2i7nA1          KLVYFE-----PKDLKSIRKYLTSNTAYGKTGIRDVHLELKNLTMRKGNLHFIRFPSCAMHRFIQMGCAT
1ax4A           AYFIKARDPKYKKEVIFDM--YKYADALTMSAGGLVAIRDNEEIFTLARQRCVYGGLAGRDMAAMVQGLE
1elqA           -----GSLPLDFSRLEVDYYAFTGHKWFGPAGVGGLIHGDCLGEINPTGKRFEVATSAYPQYAGLLAALQ
2aeuA1          VRLLFNQPPALKLGA--DLVVTSTDKLMGPRGGLLAGKKELVDKI-------------------------
1s2bA           NGSDCEFVPFSPAVEFTDCSVTSDGESVSLDDAQITQVIINNQDVTDCSVSGTTVS--------------
1fg3A           FCPQASLAGWLAE--YPHLAILTLSKAFALAGGFTLANEEVINLLXKVIAPYPLSTPVADIAAQALSPQG


                         .         *         .         .         .         .         +:350
query           XVIRSDEGGERREKLAALVQRFRAGVNASRFTLLNAHSAIQPLIVGDNSRALRLAEALRQQGCWATAIRP
1bs0A           AVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRP
1fc4A           VLEXVEAGSELRDRLWANARQFREQXSAAGFTLAGADHAIIPVXLGDAVVAQKFARELQKEGIYVTGFFY
2bwnA1          AFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVIGDPVHTKAVSDMLLSDYGVYVQPINF
1d2fA           YQQGAPWLDALRIYLKDNLTYIADKMNAAFPELNWQIYLAWLDLRPLNIDDNALQKALIEQEKVAIMPGY
2gb3A1          LNLDDSFFDFVRETYRERVETVLKKLEEHGLKRFTKPSGLPVEDAEEFARWXLTDFNXDGETTXVAPLRG
1ecxA           MEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLPNTLSPNIRGSTLQNLLSGYGIYVSTHVL
1gbnA           EVLEEENLAENADKLGIILRNELMKLPSDVVTAVRGKGLLNVIKETKDWDAWKVCLRLRDNGLL------
1iugA           VLPRLEEHLALKAWQNALLYGVGEEGGLRPVPKRFSPAVA-AFYLPEGVPYARVKEAFAQRGAV---IAG
1lc5A           QDSAWQQ--ATWHWLREEGARFYQALCQLPLLTVYPGRANYLLLRCEREDIDLQRRLLTQRILIRSCANY
1cl1A           LGVRLRQHHESSLKVAEWLAEHPQVFWKRDFTGSSGLFSFVLKKKLNNEELANYLDNFSLFSMAYSWGGY
1u08A           LRAEPEHYLALPDFYRQKRDILVNALNESRLEILPYFLLVDYSAVSTLDDVEFCQWLTQEHGVAAIPSVF
1jg8A           GIIALTKMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLAHGFIEALRNSGVLAN----
1c7nA           YKECGKWLDGCIKVIDKNQRIVKDFFEVNHPEIKEGTYLQWIDFRALKMDHKAMEEFMIHKAQIFFDEGY
1h1cA           HR---EIFEERTKFIVEERERXKSALREXGYRITDSRGNF-VFVFXEKEEKERLLEHLRTKNV---AVRS
2cfbA1          RPGSYEHLDRITGKLVQGLLDGHISGMFGLFFTAGPVTNYEQAKQSDLKKFAAFHRGMLEQGIY---LAP
1b5oA           QEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRGAFYVLMDTSPIAPDEVRAAERLLEAGV---AVVP
1c4kA2          AMQEGEAGRKLWHDLLITTIEARKKLIKAGSMFR---PFVPPVVNGKKWEDGDTEDMANNIDYW--RFEK
1pmmA           VILGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRKLKDGEDPGYTLYDLSERLRLRGWQVPAFTL
2e7iA1          TLMASFERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEVLYEISKAKGGRFFLYRELKS
1wytB1          IRTLGLEGLKKAAALAVLARYLKELLKEKGYRVPYDGPSMHEFVAQEGFRALDLAKGLLELGFHPPTVYF
1v72A1          AYLTDDLWLRNARKANAAAQRLAQGLEG--LGGVEVLGGTEANILFCRLDS-AMIDALLKAGFGF-----
1mdoA           PDLNAAIALAQLQKLDALNARDLPFQPLSLPSWEHIHFIIRVDEARCGITRDALXASLKTKGIGTGLHFR
1c0nA           EYVSALGLNNIAEYEQNLMHYALSQLESVPDLTLPQARLGVIAFNLGAHHAYDVGSFLDNYGIAVRTGHH
1dtyA           AANASLESGDWQQQVADIEVQLREQLAPARDAEMVADGAIGVVETTHPVNMAALQKFFVEQGVW------
1cs1A           LVPRMELAQRNAQAIVKYLQTYHPSLPENQGHEIAAGAMLSFELDGDEQTLRRFLGGLSLLGGVESLISH
1vefA1          AAIRYLERTRLWERAAELGPWFMEKLRAIPSPKIREVMGLMVGLELKEKAAPYIARLEKEHRVL------
1b8gA           SDKKLTKNYQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGS
1b9hA           LRAQLARLDEQIAVRDERWTLLSRLLGAVRADRNSHYMAMFRIPGLTEERRNALVDRLVEAGLPAFAAFR
1h0cA           ALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLG
1sf2A           EVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGFEDGDHNKPDAKLTAEIVARARDKG-----LIL
1bw0A           LNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGDLEKYRDIKTDVEFFEKLLEEEN---VQVLP
1m32A           ELAKEGGVAARHQRYQQNQRSLVAGXRALGFNTLLDDELHSPIITDPQYRFSEFYRRLKEQGFVIYPGKV
1bj4A           ----------------------------------------------------------------------
1agxA           ----------------------------------------------------------------------
1ohvA           -VINIIKREDLLSNAAHAGKVLLTGLLDLQARYPQGRGTFCSFDTPDESIRNKLISIARNKGVM------
3bc8A1          GCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPSLAMTLKTIDGHHDKAVTQLGSMLFTRQVSGA
1qz9A           DVFAQTDMASLRRKSLALTDLFIELVEQLTLVTPREHAKRGSHVSFEHPEGYAVIQALIDRGV-------
2fn6A1          ----------------------------------------------------------------------
1vk9A           ----------------------------------------------------------------------
1d7rA           ----------------------------------------------------------------------
1v8dA           ----------------------------------------------------------------------
1sqhA           QLIEWTQGALLTNVDLGFCNRVKELAVSRGVTAIQPRQCF------------------------------
1aamA           ILSNDALRAIWEQELTDMRQRIQR--MRQLFVTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEF
1c8nA           ----------------------------------------------------------------------
1svvA           EVLXKDNLFFELGAHSKXAAILKAGLEACGIRLAWPSASNQLFPILENT----XIAELNNDFDXYTVEP-
1xl7A1          ----------------------------------------------------------------------
1o61A           ----------------------------------------------------------------------
1vp4A           ----------------------------------------------------------------------
2z67A1          ----------------------------------------------------------------------
2i7nA1          GGGA-FKFEEDFLHKLDELDCLIQGLLY------------------------------------------
1ax4A           EGTEEEYLHYRIGQVKYLGDRLRE----------------------------------------------
1elqA           LHQRQGTAEERYQAICQRSEFLWRGLNQLPHVHCLATSAPQAGLVSDSPLGHRIVQKLEEQRIYLRTIAD
2aeuA1          ----------------------------------------------------------------------
1s2bA           ----------------------------------------------------------------------
1fg3A           IV----AXRERVAQIIAEREYLIAALKEIPCVEQVFDSE-TNYILARFKASSAVFKSLWDQG---IILRD


                         .         .         .         .         *         .         .:420
query           PTVPVGTARLRLTLTQAHEACDIDRLLEVLHGAGE
1bs0A           PTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGNG-
1fc4A           PVVPKGQARIRTQXSAAHTPEQITRAVEAFTRI--
2bwnA1          PTVPRGTERLRFTPSPVHDLKQIDGLVHAM-----
1d2fA           TYGEEGRGFVRLNA--GCPRSKLEKGVAGLINAIR
2gb3A1          FYLTPGLGKKEIRIACVLEKDLLSRAIDVL-----
1ecxA           DAMGVDRRIIRISLCKYNTEEEVDYFLKKIEEILS
1gbnA           -AKPTHGDIIRFAPPLVIKEDELRESIEII-----
1iugA           GQGPLKGKVFRLSLMGAYDRYEALGVAGMF-----
1lc5A           PGLDSRYYRVAI-----RSAAQNERLLAALR----
1cl1A           ESLIFSGTLIRLHIGLEDVDDLIADLDAGFA----
1u08A           CADPFPHKLIRLCFAKKES--TLLAAAERL-----
1jg8A           ---AVSDTEIRLVTHKDVSRNDIEEALNIF-----
1c7nA           IFGDGGIGFERINL--AAPSSVIQESLERLNKA--
1h1cA           -----FREGVRITI---GKREENDXILRELE----
2cfbA1          SQF------EAGFTSLAHTEADIERTIAAARTV--
1b5oA           GTDFAAFGHVRLSYATSEE--NLRKALERF-----
1c4kA2          GAKWHA-----------------------------
1pmmA           GGEATDIVVMRIMCRRGFEMDFAELLLEDYKAS--
2e7iA1          RKIPGLTRYFKLS-TYGLSDEEVDYVLNAFKEIIE
1wytB1          PLIVKEALMVEPTET--EAKETLEAFAEAMGALLK
1v72A1          YHDRWGPNVVRFVTSFATTAEDVDHLLNQV-----
1mdoA           AAHTQKYYRCSLPLFPDXTESDFDRVITALHQI--
1c0nA           CAMPLMAYYCRASLAMYNTHEEVDRLVTGLQRIHR
1dtyA           --IRPFGKLIYLMPPYIILPQQLQRLTAAVNRA--
1cs1A           AATMISETLLRISTGIEDGEDLIADLENGFRAANK
1vefA1          -ALQAGPTVIRFLPPLVIEKEDLERVVEAV-----
1b8gA           SCHCTEPGWFRVCFANLPER-TLDLAMQRLKAF--
1b9hA           AIYRTDAFWELGAP--DESVDAIARRCPNTDAISS
1h0cA           PSTGKVLRIGLLGCNATRE--NVDRVTEALRAA--
1sf2A           LSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC--
1bw0A           GTIFHAPGFTRLTT--TRPVEVYREAVERIKAFCQ
1m32A           SQSDC----FRIGNIGEVYAADITALLTAIRTA--
1bj4A           -----------------------------------
1agxA           -----------------------------------
1ohvA           -LGGCGDKSIRFRPTLVFRDHHAHLFLNIF-----
3bc8A1          RAVPLGNVQLNAAAAIGMKMQDVDLFIKRLDKCLN
1qz9A           IGDYREPRIMRFGFTLYTTFTEVWDAVQILGEI--
2fn6A1          -----------------------------------
1vk9A           -----------------------------------
1d7rA           -----------------------------------
1v8dA           -----------------------------------
1sqhA           -----------------------------------
1aamA           GVYAVASGRVNVA---GMTPDNMAPLCEAIV----
1c8nA           -----------------------------------
1svvA           --LKDGTCIXRLCTSWATEEKECHRFVEVLK----
1xl7A1          -----------------------------------
1o61A           -----------------------------------
1vp4A           -----------------------------------
2z67A1          -----------------------------------
2i7nA1          -----------------------------------
1ax4A           -----------------------------------
1elqA           P----DCIRACCHYITDEE--EINHLLARL-----
2aeuA1          -----------------------------------
1s2bA           -----------------------------------
1fg3A           NKQPSLSGCLRITVGTREE---SQRVIDAL-----