[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF68197.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2fckA1.bssp"
#ERROR : Can't open dsspfile "1s7fA1.bssp"
#ERROR : Can't open dsspfile "1nslA.bssp"
#ERROR : Can't open dsspfile "2ae6A1.bssp"
#ERROR : Can't open dsspfile "1vhsA.bssp"
#ERROR : Can't open dsspfile "1yreA1.bssp"
#ERROR : Can't open dsspfile "1u6mA.bssp"
#ERROR : Can't open dsspfile "1yr0A1.bssp"
#ERROR : Can't open dsspfile "1tiqA.bssp"
#ERROR : Can't open dsspfile "2fsrA1.bssp"
#ERROR : Can't open dsspfile "2fl4A1.bssp"
#ERROR : Can't open dsspfile "2fiaA1.bssp"
#ERROR : Can't open dsspfile "1yk3A1.bssp"
#ERROR : Can't open dsspfile "1wk4A.bssp"
#ERROR : Can't open dsspfile "1z4eA1.bssp"
#ERROR : Can't open dsspfile "2b3uA1.bssp"
#ERROR : Can't open dsspfile "1gheA.bssp"
#ERROR : Can't open dsspfile "1mk4A.bssp"
#ERROR : Can't open dsspfile "1s3zA.bssp"
#ERROR : Can't open dsspfile "1qsmA.bssp"
#ERROR : Can't open dsspfile "1on0A.bssp"
#ERROR : Can't open dsspfile "1lrzA3.bssp"
#ERROR : Can't open dsspfile "1ozpA.bssp"
#ERROR : Can't open dsspfile "1bo4A.bssp"
#ERROR : Can't open dsspfile "1b87A.bssp"
#ERROR : Can't open dsspfile "1i12A.bssp"
#ERROR : Can't open dsspfile "2a6aA2.bssp"
#ERROR : Can't open dsspfile "1ro5A.bssp"
#ERROR : Can't open dsspfile "2i00A2.bssp"
#ERROR : Can't open dsspfile "2bswA1.bssp"
#ERROR : Can't open dsspfile "1cm0A.bssp"
#ERROR : Can't open dsspfile "1bobA.bssp"
#ERROR : Can't open dsspfile "1m44A.bssp"
#ERROR : Can't open dsspfile "1y9kA1.bssp"

## Summary of PDB Search
:179
    4e-32  25%  2fckA1 [d.108.1.1] RIBOSOMAL-PROTEIN-SERINE ACETYLTRANSFERASE, A:1
    6e-18  90%  1s7fA1 [d.108.1.1] ACETYL TRANSFERASE A:1 -- 176
    6e-18  23%  1nslA  [d.108.1.1] PROBABLE ACETYLTRANSFERASE
    4e-17  26%  2ae6A1 [d.108.1.1] ACETYLTRANSFERASE, GNAT FAMILY A:1 -- 161
    2e-16  20%  1vhsA  [d.108.1.1] SIMILAR TO PHOSPHINOTHRICIN ACETYLTRANSFERASE
    8e-15  20%  1yreA1 [d.108.1.1] HYPOTHETICAL PROTEIN PA3270 A:11 -- 193
    1e-13  15%  1u6mA  [d.108.1.1] ACETYLTRANSFERASE, GNAT FAMILY
    1e-13  20%  1yr0A1 [d.108.1.1] PHOSPHINOTHRICIN ACETYLTRANSFERASE A:4 -- 166
    1e-13  13%  1tiqA  [d.108.1.1] PROTEASE SYNTHASE AND SPORULATION NEGATIVE
    2e-13  20%  2fsrA1 [d.108.1.1] ACETYLTRANFERASE A:4 -- 167
    3e-11  11%  2fl4A1 [d.108.1.1] SPERMINE/SPERMIDINE ACETYLTRANSFERASE A:1 -- 146
    1e-10  14%  2fiaA1 [d.108.1.1] ACETYLTRANSFERASE A:1 -- 157
    1e-10  12%  1yk3A1 [d.108.1.1] HYPOTHETICAL PROTEIN RV1347C/MT1389 A:10 -- 207
    2e-10   8%  1wk4A  [d.108.1.1] TTK003001606
    2e-10  12%  1z4eA1 [d.108.1.1] TRANSCRIPTIONAL REGULATOR A:4 -- 153
    4e-10  13%  2b3uA1 [d.108.1.1] DIAMINE ACETYLTRANSFERASE 1 A:2 -- 170
    6e-10   9%  1gheA  [d.108.1.1] ACETYLTRANSFERASE
    7e-10  15%  1mk4A  [d.108.1.1] HYPOTHETICAL PROTEIN YQJY
    1e-09  11%  1s3zA  [d.108.1.1] AMINOGLYCOSIDE 6'-N-ACETYLTRANSFERASE
    4e-09   9%  1qsmA  [d.108.1.1] HPA2 HISTONE ACETYLTRANSFERASE
    1e-08  18%  1on0A  [d.108.1.1] YYCN PROTEIN
    4e-08   5%  1lrzA3 [d.108.1.4] FACTOR ESSENTIAL FOR EXPRESSION OF METHICILLIN
    5e-08  13%  1ozpA  [d.108.1.1] HYPOTHETICAL PROTEIN RV0819
    6e-08  10%  1bo4A  [d.108.1.1] PROTEIN (SERRATIA MARCESCENS AMINOGLYCOSIDE-3-N-
    9e-08   8%  1b87A  [d.108.1.1] PROTEIN (AMINOGLYCOSIDE N6'-ACETYLTRANSFERASE
    2e-07  10%  1i12A  [d.108.1.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    2e-07  12%  2a6aA2 [c.55.1.9] HYPOTHETICAL PROTEIN TM0874 A:104 -- 193
    3e-07  12%  1ro5A  [d.108.1.3] AUTOINDUCER SYNTHESIS PROTEIN LASI
    6e-06   9%  2i00A2 [d.108.1.10] ACETYLTRANSFERASE, GNAT FAMILY A:10 -- 300
    7e-06  10%  2bswA1 [d.108.1.1] GLYPHOSATE N-ACETYLTRANSFERASE A:2 -- 146
    2e-05  13%  1cm0A  [d.108.1.1] P300/CBP ASSOCIATING FACTOR
    3e-05  11%  1bobA  [d.108.1.1] HISTONE ACETYLTRANSFERASE
    2e-04  12%  1m44A  [d.108.1.1] AMINOGLYCOSIDE 2'-N-ACETYLTRANSFERASE
    2e-04  20%  1y9kA1 [d.108.1.1] IAA ACETYLTRANSFERASE A:1 -- 152
:179

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPQYVTSQEETRKHVQGNMLLHQRGYAKMY
2fckA1          ----------LQLRLITADEAEELVQCIRQSQT-LHQWVDW----FSQQEAEQFIQATRLNWVKAEAYGF
1s7fA1          MVEIIPVSTTLELRAADESHVPALHQLVLKNKAWLQQSLDWPTSQEETRKHVQGNIL---LHQRGYAKMY
1nslA           ---TCKVNEHITIRLLEPKDAERLAELIIQNQQRLGKWLFFSSADTYRETIIPDWRR---QYADLNGIEA
2ae6A1          -------STSLTIRLVAEADWPALHAL--------DQIISLAAY---QEKXKDET-------------IF
1vhsA           ---------SLTLRLAEHRDLEAVVAIY--NSTIASRXVTADTEPVTPEDRXEWFSG----HTESRPLYV
1yreA1          ---------ALRLEPLVEADIPELVSLAEANREALQ----YMDGPTRPDWYRQSLAE----QREGRALPL
1u6mA           VLVILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEAGIAVGYPAEDEKIIDEPLRE
1yr0A1          ---------SVELRDATVDDLSGIXEIY--NDAVVNTTAIWNEVVVDLENRKDWFAART---SRGFP-VI
1tiqA           ---------SVKXKKCSREDLQTLQQLSIETFNDTFKEQNSPENXKAYLESAFNTEQLEKELSNXSSQFF
2fsrA1          ----------LTLRPLAXADFPAYRDFX---ASPRSTGVGGPYDLPSTWGVFCHDLANWHFFGHGALX-I
2fl4A1          ---------EIHFEKVTSDNRKAVEN-------LQVFAEQQAFIESMAENLKESDQFPEWES-------A
2fiaA1          ----------MKIRVADEKELPMIL-------QFLTEVKAYMDVVGITQWTKDYPSQGDIQEDITKKRLY
1yk3A1          -------EPPYGLRVAQLTDAEMLAEWMNRLAAAWEYDWPASRWRQHLNAQLEGTYSLPLIGSWHGTDGG
1wk4A           ----------VRIRRAGLEDLPGVARVLVDTWRATYRGVVPEAFLEGYEGQAERWAQRLKTPTWPGRLFV
1z4eA1          ----------VTIREATEGDLEQMVHMLADDVLGRKRERYEKPLPVSYVRAFKE------IKKDKNNELI
2b3uA1          ----------FVIRPATAADCSDILRLIKELAQVILTEKDLLEDGFGEHPFYHC-------LVAEVPKEH
1gheA           -----------QLRRVTAESFAHYRHGLAQLLFETVHGGASVGFDLDXQQAYAWCDGLKADIAAGSLLLW
1mk4A           ----------MDIRTITSSDYEMVTSVLNEWWGGRQLKEKLPRLFFEHFQDT----------------SF
1s3zA           --------SHMDIRQMNKTHLEHWRG-------LRKQLWPGHPDDAHLADGEEILQ-------ADHLASF
1qsmA           ----------ITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDP-------NIKMWAAVA
1on0A           ---------TIXLTPXQTEEFRSYLTYTTK--HYAEEKVKAGTWLPEDAQLLSKQVFTDLLPRGLETPHH
1lrzA3          ---------------------------------------ELPIF---RSFMDDKFYYNRLKYYKDRVLVP
1ozpA           ----------------------------------------FAGHPEQGGWTAVQLAERRGEAWFDPDGLI
1bo4A           ----------IRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLR-------SKTFIAL
1b87A           ----------MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPE------------RIAV
1i12A           -------PDGFYIRRMEEGDLEQVTETL--KVLTTVGTITPESFCKLIKYWNEATVWNDKKIMQYNPMVI
2a6aA2          ----------------------------------------------------------------------
1ro5A           ---------IGRREEFDKKLLGEMHKL---RAQVFKERKGWDVSVIDEMEIDGYEDGQVFGCWRILDTTG
2i00A2          ----------LTLKPVEEEHIDQFNELLSYVFQVTEADIEESGFENKRAFIKSKQPILELSKVFGWFHEN
2bswA1          ----------IEVKPINAEDTYELRHRIL---RPNQPIEACXFESDLLRGAF----------------HL
1cm0A           ----------IEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVF-------DPKHKTL
1bobA           --------------------------------VDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWL
1m44A           ---------LVHTADLDSETRQDIRQM-------VTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAA
1y9kA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LIFCQNEMAGVLSFNAIEPVNKAAYIGYWLDESLQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
2fckA1          GVFERQTLVGXVAINEFYHTFNXASLGYWIGDRYQRQGYGKEALTALILFCFERLELTRLEIVCDPENVP
1s7fA1          LIFCQNEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQA
1nslA           GLLYDGSLCGXISLHNLDQVNRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNRVAICAAVGNEK
2ae6A1          VAISGQQLAGFIEVHPPTSLQKQWLLSIGVSPDFQDQGIGGSLLSYIKDXAEISG-IHKLSLRVXATNQE
1vhsA           AEDENGNVAAWISFYGRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPNLG-IRSLXAFIFGHNKP
1yreA1          AVRLGVQLVGTTRFAEFLPALPACEIGWTLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLR
1u6mA           VFKKHGLAEDVRLFIEEETLPNEWYLDTSVDERFRGMGIGSKLLDALP-EVAKASGKQALGLNVDFDNPG
1yr0A1          VAILDGKVAGYASWRAFDGYRHTREHSVYVHKDARGHGIGKRLXQALIDH-AGGNDVHVLIAAIEAENTA
1tiqA           FIYFDHEIAGYVKVNIDDAQSESLEIERYIKNSFQKHGLGKHLLNKAI-EIALERNKKNIWLGVWEKNEN
2fsrA1          DLGETGECIGQIGINHGPL-FPEKELGWLLYEGHEGRGYAAEAAVALRDWAFETLNLPTLVSYVSPQNRK
2fl4A1          GIYDGNQLIGYAMYGRWQD-GRVWLDRFLIDQRFQGQGYGKAACRLLMLKLIEKYQTNKLYLSVYDTNSS
2fiaA1          LLVHEEMIFSMATFCMEQEQDFVWLKRFATSPNYIAKGYGSLLFHELE-KRAVWEGRRKMYAQTNHTNHR
1yk3A1          YLELYWAAKDLISHYYDADPYDLGLHAAIADLSKVNRGFGPLLLPRIVASFANEPRCRRIMFDPDHRNTA
1wk4A           AESESGEFAAFGPDRASGFPGYTAELWAYVLPTWQRKGLGRALFHEGA-RLLQAEGYGRXLVWVLKENPK
1z4eA1          VACNGEEIVGMLQVTFTPYLTYQGSEGVRTHSAARGQGIGSQLVCWAI-ERAKERGCHLIQLTTDKQRPD
2b3uA1          WTPEGHSIVGFYYFTYDPWIGKLLYLEFFVXSDYRGFGIGSEILKNLSQVAXRCR-CSSXHFLVAEWNEP
1gheA           VVAEDDNVLASAQLSLCPNGLNRAEVQKLVLPSARGRGLGRQLXDEVEQVAVKHKRGLLHL--DTEAGSV
1mk4A           ITSEHNSMTGFLIGFQSQSDPETAYIHSGVHPDFRKMQIGKQLYDVFI-ETVKQRGCTRVKCVTSPVNKV
1s3zA           IAMADGVAIGFADASIRHDYVNVFLEGIFVLPSFRQRGVAKQLIAAVQ-RWGTNKGCREMASDTSPENTI
1qsmA           VESSSEKIIGFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVY-DEADKLGTPSVYWCTDESNHR
1on0A           HLWSEKDIVGWLWIHAEEHPQQEAFIDFGLYEPYRGKGYAKQALAAL-DQAARSXGIRKLSLHVFAHNQT
1lrzA3          LAYINELPISAGFFF---INPFEVVYYAGTSNAFRHFAGSYAVQWEMINYALNHGYGVSGKFTEDAEDAG
1ozpA           LAFGDGRLLGFHWTKVHPDHPGGEVYVLGVDPAAQRRGLGQMLTSIGIVSLARRLVEPAVLLYVESDNVA
1bo4A           AAFDQEAVVGALAAYVLPKFEQIYIYDLAVSGEHRRQGIATALINLLK-HEANALGAYVIYVQADYGDDP
1b87A           AAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLE-KEVASRGGITIYLGTDDLDHG
1i12A           VDKRTETVAATGNIIIEHELGLCGHIEIAVNSKYQGQGLGKLLIDQLV-TIGFDYGCYKIILDCDEKNV-
2a6aA2          ----------------RRARKGYHYCAYLKDKGLNPLKEPSVVSDEEL-EEITKEFSPKIVLKDDLLISP
1ro5A           PYMLKNTFPELLHGKEAPCSPHIWELSRAINSGQKGSLGFSDCTLEAMRALARYSLQNDIQTLVTVTTVG
2i00A2          QLISQIAIYPCEVNIHGALYKMGGVTGVGTYPEYANHGLMKDLIQTALEEMRQDK------QWISYLFPY
2bswA1          GGYYGGKLISIASFHQALQGQKQYQLRGATLEGYREQKAGSSLIKHAE-EILRKRGADLLWCNA---RTS
1cm0A           ALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNH-LKEYHIKHDILNFLT---YADEY
1bobA           LNKKTKELIGFVTTWHYIDKKFRAKISQFLFPPYQNKGHGSCLYEAIIQSWLEDKSITEIT--VEDPNEA
1m44A           VIQRR-----LIYRGNALRC---GYVEGAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLY
1y9kA1          ------------------------------AEHLQGKGIGKKLLRHAV-ETAKGYGXSKLEVGTGNSSVS


                         +         .         .         .         .         *         .:210
query           SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARIIDAD
2fckA1          SQALALRCGANREQLAPNRFLYAGEPKAGIVFS------
1s7fA1          SNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARII---
1nslA           SRAVPERIGFLEEGKARDGLYVNGXHHDLVYYSLLKR--
2ae6A1          AIRFYEKHGFVQEAHFKEEFYINGHYCDDYQYAYFI---
1vhsA           SLKLFEKHGFAEWGLFPGIAEXDGKRYDLKILGRELS--
1yreA1          AQGAIDKLGAQREGVLRNHRRLGGRLDDTFVYSIT----
1u6mA           ARKLYASKGFKDVTTMTISGHLYNHMQK-----------
1yr0A1          SIRLHESLGFRVVGRFSEVGTKFGRWLDL----------
1tiqA           AIAFYKKXGFVQTGAHSFYXGDEEQTDLIXAKTLILE--
2fsrA1          SAAVAERIGGTLDPLAPRSDPEDLVYRY-----------
2fl4A1          AIRLYQQLGFVFNGELDTNGERVMEW-------------
2fiaA1          MIRFFESKGFTKIHESLQMNRLDFGSFYL----------
1yk3A1          TRRLCEWAGCKFLG------EHDTTNRRMALYALEAP--
1wk4A           GRGFYEHLGGVLLGEREIELGGAKLWEVA-YGFDLGGHK
1z4eA1          ALRFYEQLGFKASHEGLK---------------------
2b3uA1          SINFYKRRGASDLSSEEGWRLIDKEYLL-----------
1gheA           AEAFYSALAYTRVGELPGCATPDGRLHPTAIYFKTL---
1mk4A           SIAYHTKLGFDIEKGTKTVNNYDGPGQDRVLFVK-----
1s3zA           SQKVHQALGFEETERVIFYRK------------------
1qsmA           AQLLYVKVGYKAPKILYKRKG------------------
1on0A           ARKLYEQTGFQETDVVXS---------------------
1lrzA3          VVKFKKGYNAEIIEYVGDFIKPINKPVY-----------
1ozpA           AVRTYQSLGFTTYSVDTA---------------------
1bo4A           AVALYTK--------------------------------
1b87A           TTLSQTDLYEHTFDKVASIQNLREHPYEF----------
1i12A           --KFYEKCGFSNAGVEMQ---------------------
2a6aA2          AVLVEESERLFREKKTIHYYEIEP---------------
1ro5A           VEKMMIRAGLDVSRFGP--HLKIGIERAVALRIELNAKT
2i00A2          NIPYYRRKGWEIMSDKLSFKIRDTQLPKTVPVPGMIE--
2bswA1          ASGYYKKLGFSEQGEVFDTPPVGPHILXY----------
1cm0A           AIGYFKKQGFSKEIKIPKTKYVIKDYEGATLMGCELN--
1bobA           FDDLRDRNDIQRLRKLG--YDAVFQKHSDLSDEFLESS-
1m44A           ASRGWLPWHGPT-SVLAPTGPVRTPDDDGTVFVLPIDIS
1y9kA1          QLALYQKCGFRIFSIDF-------DYFSKHYEEEIIE--