[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF68340.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2j2zB1.bssp"
#ERROR : Can't open dsspfile "2uy6B1.bssp"
#ERROR : Can't open dsspfile "1pdkB.bssp"
#ERROR : Can't open dsspfile "1kiuB2.bssp"

## Summary of PDB Search
:172
    6e-26  23%  2j2zB1 [b.2.3.2] PAP FIMBRIAL MINOR PILIN PROTEIN B:24 -- 173
    5e-25  29%  2uy6B1 [b.2.3.2] PAP FIMBRIAL MAJOR PILIN PROTEIN B:10 -- 163
    1e-22  30%  1pdkB  [b.2.3.2] PROTEIN (PROTEIN PAPK)
    3e-20  20%  1kiuB2 [b.2.3.2] FIMH PROTEIN B:159 -- 279
:172

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxRVYVSGTITDNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFA
2j2zB1          -----------------------RAAFHGEVVRPACTLAMEDAWQIIDMGETPVRDLQ-NGFSGPERKFS
2uy6B1          -----------------------KVTFNNTVVDAPCSISQKSADQSIDFGQLSKSFLE-AGGVSKPMDLD
1pdkB           ------------------------------LLDRPCHVSGDSLNKHVVFKTRASRDFWYPPGRSPTESFV
1kiuB2          ----------------------------------GCDVSAR--DVTVTLPDYPGSV-----------PIP


                         .         .         *         .         .         .         .:140
query           IDLQNCGSTASGVTVSFSGAADSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQAS
2j2zB1          LRLRNCEFNSQGIRVTFDGVRGE-TPDKFNLS---GQAKGINLQIADVRGNIARAGKVMPAIPLTGNEEA
2uy6B1          IELVNCKGGKGTVKLAFTGPIVNGHSDELDTNG----GTGLAIVVQGAGKNVVFDGSEGDANTLKDGENV
1pdkB           IRLENCHATAVGVTLTFKGTEEAALPGHLKVTGVNAGRLGIALLDTDGSSLLKPGTSHNKGQGEKVTGNS
1kiuB2          LTVYCAK--SQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTI-IPANNTVSLGAVGTSAVS


                         +         .         .         .         .         *         .:210
query           AHLQFYARYLADGGAVTPGDANASATFILAYE
2j2zB1          --LDYTLRIVRNGKKLEAGNYFAVLGFRVDYE
2uy6B1          LHYTVVKKSSAVGAAVTEGAFSAVANFNLTYQ
1pdkB           LELPFGAYVVARTKSVVPGDYEATATFELTY-
1kiuB2          LG--LTANYARTGGQVTAGNVQSIIGVTFVYQ