[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF68451.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xngA1.bssp"
#ERROR : Can't open dsspfile "1jgtA1.bssp"
#ERROR : Can't open dsspfile "1q15A1.bssp"
#ERROR : Can't open dsspfile "1k92A1.bssp"
#ERROR : Can't open dsspfile "2c5sA1.bssp"
#ERROR : Can't open dsspfile "1gpmA1.bssp"
#ERROR : Can't open dsspfile "1ni5A1.bssp"
#ERROR : Can't open dsspfile "1wy5A1.bssp"
#ERROR : Can't open dsspfile "1vbkA1.bssp"
#ERROR : Can't open dsspfile "1surA.bssp"

## Summary of PDB Search
:368
    2e-30  18%  1xngA1 [c.26.2.1] NH(3)-DEPENDENT NAD(+) SYNTHETASE A:3 -- 257
    2e-30  12%  1jgtA1 [c.26.2.1] BETA-LACTAM SYNTHETASE A:210 -- 508
    8e-25   9%  1q15A1 [c.26.2.1] CARA A:206 -- 501
    4e-22  10%  1k92A1 [c.26.2.1] ARGININOSUCCINATE SYNTHASE A:1 -- 188
    2e-20  15%  2c5sA1 [c.26.2.6] PROBABLE THIAMINE BIOSYNTHESIS PROTEIN THII A:174
    4e-15  19%  1gpmA1 [c.26.2.1] GMP SYNTHETASE A:208 -- 404
    6e-15  11%  1ni5A1 [c.26.2.5] PUTATIVE CELL CYCLE PROTEIN MESJ A:0 -- 226
    5e-14  10%  1wy5A1 [c.26.2.5] HYPOTHETICAL UPF0072 PROTEIN AQ_1887 A:1 -- 216
    5e-06  13%  1vbkA1 [c.26.2.6] HYPOTHETICAL PROTEIN PH1313 A:176 -- 307
    1e-04  17%  1surA  [c.26.2.2] PAPS REDUCTASE
:368

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxAWLLQQQGYQVEGLFMKNWEEDDGEEYCTXXXXXXXXXXVCDKLGIELH
1xngA1          ---------------------GVLCQKV-------FKENAHALLMPSSVSMPENKTDALNLCEKFSIPYT
1jgtA1          ---------------------AACAHRAAGELDTVSMGTDTSNEFRE----------ARAVVDHLRTRHR
1q15A1          ---------------------TALASRHFKKLNTYSIGTELSNEFEF----------SQQVADALGTHHQ
1k92A1          ---------------------LLWMRQKGAVPYAYTANLGQPDEEDY--------DAIPRRAMEYGAENA
2c5sA1          ---------------------AYLTMKRGVSVEAVHFHSPPFTSERAK-------QKVIDLAQELTKYCK
1gpmA1          ---------------------AMLLHRAIGKNLTCVFVDNGLLRLNE------AEQVLDMFGDHFGLNIV
1ni5A1          ---------------------LHQLVQWRTENPGVALRAIHVHHGLSANADAWVTHCEN-VCQQWQVPLV
1wy5A1          ----------------------DVLLKLKNYFSLKEVALAHFNHMLR-ESAERDEEFCKEFAKERNMKIF
1vbkA1          ---------------------IFLMMKRGVEVIPVYIGKDDKNLEKVRSLWN--------LLKRYSYGSK
1surA           ---------------------LHLVNQIRPDIPVILTDGYLFPETYRFI---------DELTDKLKLNLK


                         .         .         *         .         .         .         .:140
query           TVNFAAEYWDNVFELFLEEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADVNGKSR
1xngA1          EYSI--APYDAIFSSHFKDASLTRKGN---FCAR-LRMAFLYDYSLK-SDSLVIGTSN------------
1jgtA1          EITIPTTELLAQLPYAV---WASESVDPDIIEYLLPLT--ALYRALDGPERRILTGYGMHRDRLPALDTV
1q15A1          MKILSETEV---INGIIESIYYNEIFDGLSAEIQSGLF---NVYRQAQGQVSCMLTGYKPGAQYDNPNQL
1k92A1          RKQLVAEGIAAIQCGAFHNTTGGLTYFNTTPLGRAVTGTMLVAAMKE-DGVNIWGDGSTYKGNDIERFYR
2c5sA1          RVTLHLVPFTEVQKTINKEIP-----SSYSMTVMRRMMMRITERIAEERNALAITTGESLG---------
1gpmA1          HVP--------AEDRFLSALAGENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGT------------
1ni5A1          VERVQLAQEGLGIEA----------------QARQARYQAF---ARTLLPGEVLVTAQHLDDQCETFLLA
1wy5A1          VGKEDVRAF------------AKENRMSLEEAGRFLRYKFLKEILESE-GFDCIATAHHLNDLLETSLLF
1vbkA1          GFLVVAESFD------------------------------RVLKLIRDFGVKGVIKGLR-----------
1surA           VYRASAAWQEARYGKLWEQGVEGIE-----KYNDINKVEPMNRALKE-LNAQTWFAGL--RREQSGSRAN


                         +         .         .         .         .         *         .:210
query           LLRGLDGNKDQSYFLYTLGHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFRDFL
1xngA1          --------KSERMLGYGTLFGDLACAINPIGELFKTEVYELARRLNIPKKLNKPPSADLFVGQSDEKDLG
1jgtA1          LAHDMATFDGLNEMSPVLSTLAGHWTTHPYWD-----REVLDLLVSLEAGLKRRHGRDKWVLRAAMADAL
1q15A1          LAEQVYRTRWTGEFATHGASCYGIDIRHPFWSHSLISLC-----HALHPDYKIFDNEVKNILREYADSLQ
1k92A1          YGLLTNAELQI--------YKPWLDTDFIDELGGRHEMSEFMIACGFDYKMSVE----------------
2c5sA1          -----QVASQTLDSMHTINEVTNYPVIRPLITMDKLEIIKIAEEIGTYDISIRPKREKANRFEYDFTPLI
1gpmA1          -------IYPDVIESAAKMG-----LVEPLKELFKDEVRKIGLELGLPYDMLYR----------------
1ni5A1          LKR--GSGPAGLSAXAEVSEFAGTRLIRPLLARTRGELVQWARQYDLRWIEDESNQDDSY----------
1wy5A1          FTRGTGLDGLIGF------LPKEEVIRRPLYYVKRSEIEEYAKFKGLRWVEDETNYEVSI-----PRNRI
1vbkA1          ----PNDLNSEVSEITEDFKMFPVPVYYPLIALPEEYIKSVKERLGL-----------------------
1surA           L---------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKGLGIGGTKDGSEDPWYVVDKDVENNVLIVAQGHEHP
1xngA1          YPYSVIDP---LLKDIEALFQTKPIDTETLAQLG-----------------YDEILVKNITSRIQKNAFK
1jgtA1          PAETVNRPSRLLLDHGVAEDRVHEAKRQVVRELFDLTVGGGR-----HPSEVDTDDVVRSVA--------
1q15A1          LLPKDILGSTVDNYQTKSRFTYRVYQAFLRGR-----LSITDVTPSQLKDLI------------------
1k92A1          ----------------------------------------------------------------------
2c5sA1          DEAVANKETMVLQ---------------------------------------------------------
1gpmA1          ----------------------------------------------------------------------
1ni5A1          ----------------------------------------------------------------------
1wy5A1          RHRV------------------------------------------------------------------
1vbkA1          ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RLMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xngA1          LEL-------------------------------------------------------------------
1jgtA1          ----------------------------------------------------------------------
1q15A1          ----------------------------------------------------------------------
1k92A1          ----------------------------------------------------------------------
2c5sA1          ----------------------------------------------------------------------
1gpmA1          ----------------------------------------------------------------------
1ni5A1          ----------------------------------------------------------------------
1wy5A1          ----------------------------------------------------------------------
1vbkA1          ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxx
1xngA1          ------------------
1jgtA1          ------------------
1q15A1          ------------------
1k92A1          ------------------
2c5sA1          ------------------
1gpmA1          ------------------
1ni5A1          ------------------
1wy5A1          ------------------
1vbkA1          ------------------
1surA           ------------------