[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF68462.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bg6A1.bssp"
#ERROR : Can't open dsspfile "1w53A.bssp"
#ERROR : Can't open dsspfile "1txgA2.bssp"
#ERROR : Can't open dsspfile "1pgjA2.bssp"
#ERROR : Can't open dsspfile "1ks9A2.bssp"
#ERROR : Can't open dsspfile "2f1kA2.bssp"
#ERROR : Can't open dsspfile "1jaxA.bssp"
#ERROR : Can't open dsspfile "2avnA1.bssp"

## Summary of PDB Search
:305
    2e-15  15%  1bg6A1 [a.100.1.5] N-(1-D-CARBOXYLETHYL)-L-NORVALINE DEHYDROGENASE
    1e-11  13%  1w53A  [a.186.1.2] PHOSPHOSERINE PHOSPHATASE RSBU
    4e-07  11%  1txgA2 [c.2.1.6] GLYCEROL-3-PHOSPHATE DEHYDROGENASE [NAD(P)+] A:1
    2e-06  14%  1pgjA2 [c.2.1.6] 6-PHOSPHOGLUCONATE DEHYDROGENASE A:1 -- 178
    2e-05  15%  1ks9A2 [c.2.1.6] 2-DEHYDROPANTOATE 2-REDUCTASE A:1 -- 167
    4e-05  16%  2f1kA2 [c.2.1.6] PREPHENATE DEHYDROGENASE A:1 -- 165
    4e-04  12%  1jaxA  [c.2.1.6] CONSERVED HYPOTHETICAL PROTEIN
    8e-04  27%  2avnA1 [c.66.1.41] UBIQUINONE/MENAQUINONE BIOSYNTHESIS A:1 -- 246
:305

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKXXXXXXXXMGCRFGYMLLEAGHDVTLIDGWQEHVDAIRSKGLFVETETTQKYYPIPAMLADESQGEFE
1bg6A1          ----------------------------------------------------------------------
1w53A           ----------------------------------------------------------------------
1txgA2          MIVSILGAGAMGSALSVPLVDNGNEVRIWGTEFDTEILKSGREHPRLGVKLNGVEIFWPEQLEKCLENAE
1pgjA2          ----------MGANLALNIAEKGFKVAVFNRTYSKSEEFMKANASAPFAGNLKAFETMEAFAASLKKPRK
1ks9A2          MKITVLGCGALGQLWLTALCKQGHEVQGWLRVPQPYCSVNLVE-----TDGSIFNESLTANDPDFLATSD
2f1kA2          MKIGVVGLGLIGASLAGDLRRRGHYLIGVSRQQSTCEKAVERQLVDEAGQDLSLLQ-----------TAK
1jaxA           ------------------LATLGHEIVVGSRREEKAEA-------KAAEYRRIAGDITGMKNEDAAEACD
2avnA1          -----------GGKWSLFLQERGFEVVLVDPSKEXLEVAREKGVKNVVEAKAEDLPFPS-------GAFE


                         .         .         *         .         .         .         .:140
query           LVILFTKAMQLDSMLQRIKPLLPAAKVVMILSNGLGNIETLEKYVDRQKIYAGVTLWSSELEGAGHIMAT
1bg6A1          ----------------------------------------------------------------------
1w53A           ----------------------------------------------------------------------
1txgA2          VVLLGVSTDGVLPVMSRILPYLKDQYIVLISKGLIFDNSVLTVPEAVWRLKHDLRERTVAITGPAIAREV
1pgjA2          ALILVQAGAATDSTIEQLKKVFEKGDILVDTGNA------------------------------------
1ks9A2          LLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIEELQNIQQPL---LMGTTTHAARRDGNVIIHV
2f1kA2          IIFLCTPIQLILPTLEKLIPHLSPTAIVTDVASVKTAI--------------------------------
1jaxA           IAVLTIPWEHAIDTARDLKNILREKIVVSPLVP--VSRGAKGFTYSSERSAAEIVVSALHTIPAARFANL
2avnA1          AVLALGDVLSKDKAFSEIRRVLPDGLLIATVDN-------------------------------------


                         +         .         .         .         .         *         .:210
query           GTGTIELQPIASQDSAQEAKVIATLNSAGLNAEISPDVLLSIWKKAAFNSVMNTYCALLDCNVGGFGQRP
1bg6A1          ------------------------------------------------NAVMHPLPTLLNAARCESGTPP
1w53A           ---------------------------------------------------------------------Q
1txgA2          AKRMPTTVVFSSPSESSANKMKEIFETEYFGVEVT-----------------------------------
1pgjA2          ----------------------------------------------------------------------
1ks9A2          ANGIT--HIGPARQQDGDYSYLA-----------------------------------------------
2f1kA2          ----------------------------------------------------------------------
1jaxA           DEKFDWDVPVCGDDDESKKVVMSLISEIDGLRPL-DAGPLSNSRLVESLTPLILNIMR------------
2avnA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GALDLAQAVVDEFVLVAASQNIPLTEQMVMNTVKKVFDPRESGHHYPSMHQDLHKGRLTEIDYLNGAIAR
1bg6A1          SVGSLAEKVDAERIAIAKAFDLNVPSVCEWYPATIYEAVQGNPAYRGIAGPINLNTRFEDVSTGLVPLSE
1w53A           RYHQLLSRYIAELTETSLYQAQKFSRKTIEHQIPPEIHRKVLKELYPSLPEDVFHSLDFLIEVMIGYGMA
1txgA2          ----------------------------------------------------------------------
1pgjA2          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
2f1kA2          ----------------------------------------------------------------------
1jaxA           ----------------------------------------------------------------------
2avnA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           IGAQNNIAVPVNKLLTQLIHAKEAQ
1bg6A1          LGRAVNVPTPLIDAVLDLISSLIDT
1w53A           -------------------------
1txgA2          -------------------------
1pgjA2          -------------------------
1ks9A2          -------------------------
2f1kA2          -------------------------
1jaxA           -------------------------
2avnA1          -------------------------