[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF68493.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1v4aA1.bssp"
#ERROR : Can't open dsspfile "1bl0A2.bssp"
#ERROR : Can't open dsspfile "1d5yA2.bssp"
#ERROR : Can't open dsspfile "1bl0A1.bssp"
#ERROR : Can't open dsspfile "1q05A.bssp"

## Summary of PDB Search
:334
    2e-14  11%  1v4aA1 [a.24.16.4] GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE
    8e-09  15%  1bl0A2 [a.4.1.8] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN)
    1e-08  20%  1d5yA2 [a.4.1.8] ROB TRANSCRIPTION FACTOR A:57 -- 121
    4e-06  24%  1bl0A1 [a.4.1.8] PROTEIN (MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN)
    1e-05   8%  1q05A  [a.6.1.3] TRANSCRIPTIONAL REGULATOR CUER[MASQUE : MEMB(X) 0 /
:334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v4aA1          ----------------------------------------------------------------------
1bl0A2          ----------------------------------------------------------------------
1d5yA2          ----------------------------------------------------------------------
1bl0A1          ----------------------------------------------------------------------
1q05A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v4aA1          ----------------------------------------------------------------------
1bl0A2          ----------------------------------------------------------------------
1d5yA2          ----------------------------------------------------------------------
1bl0A1          ----------------------------------------------------------------------
1q05A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v4aA1          ----------------------------------------------------------------------
1bl0A2          ----------------------------------------------------------------------
1d5yA2          ----------------------------------------------------------------------
1bl0A1          ----------------------------------------------------------------------
1q05A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxQTPEKAYTLNELARRAAMSPSSLRCKFRHAYGCTVFDYLRDCRLA
1v4aA1          -------------------------QSRSLLPTLSAIAELHLLSENDAEQLRVAYLFLRRLENLLQSIND
1bl0A2          -------------------------------------------------------------------KMT
1d5yA2          -------------------------------------------------------------------RLS
1bl0A1          ---------------------------LESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIR-----
1q05A           --------------------------------NISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYELT


                         .         *         .         .         .         .         +:350
query           RARRYLMEGYSVQQAAWMSGYQHATNFATAFRRRYGCSPGELRxxxxxxxxxxx
1v4aA1          EQTQTLPSELNRARLAWAXDFADWPQLTGALTAHXTNVRRVFN-----------
1bl0A2          EIAQKLKESEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYR-----------
1d5yA2          KSAVALRLTRPILDIALQYRFDSQQTFTRAFKKQFAQTPALYR-----------
1bl0A1          ------------------------------------------------------
1q05A           LLRQARQVGFNLEESGELVNLFNDPQRHSADVK---------------------