[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF68510.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1g59A2.bssp"
#ERROR : Can't open dsspfile "1nzjA.bssp"
#ERROR : Can't open dsspfile "1euqA1.bssp"
#ERROR : Can't open dsspfile "1euqA2.bssp"
#ERROR : Can't open dsspfile "1f4lA2.bssp"
#ERROR : Can't open dsspfile "1a8hA2.bssp"
#ERROR : Can't open dsspfile "1rqgA2.bssp"
#ERROR : Can't open dsspfile "1gaxA3.bssp"
#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "1j1uA.bssp"
#ERROR : Can't open dsspfile "1irxA2.bssp"
#ERROR : Can't open dsspfile "1iq0A2.bssp"
#ERROR : Can't open dsspfile "1ffyA3.bssp"
#ERROR : Can't open dsspfile "1li5A2.bssp"
#ERROR : Can't open dsspfile "1h3nA3.bssp"
#ERROR : Can't open dsspfile "1ileA3.bssp"
#ERROR : Can't open dsspfile "1jeqA3.bssp"
#ERROR : Can't open dsspfile "1qhuA1.bssp"
#ERROR : Can't open dsspfile "2np5A1.bssp"
#ERROR : Can't open dsspfile "2fq4A1.bssp"
#ERROR : Can't open dsspfile "2g3bA1.bssp"
#ERROR : Can't open dsspfile "1c4kA1.bssp"
#ERROR : Can't open dsspfile "1pb6A1.bssp"
#ERROR : Can't open dsspfile "2g7sA1.bssp"

## Summary of PDB Search
:555
    2e-75  24%  1g59A2 [c.26.1.1] GLUTAMYL-TRNA SYNTHETASE A:1 -- 305
    6e-59  21%  1nzjA  [c.26.1.1] HYPOTHETICAL PROTEIN YADB
    4e-57  91%  1euqA1 [b.53.1.2] GLUTAMINYL-TRNA SYNTHETASE A:339 -- 547
    4e-45  98%  1euqA2 [c.26.1.1] GLUTAMINYL-TRNA SYNTHETASE A:8 -- 338
    6e-41  11%  1f4lA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:4 -- 140 A:176 -- 388
    2e-38  12%  1a8hA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 348
    8e-38  11%  1rqgA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 138 A:174 -- 396
    1e-34  11%  1gaxA3 [c.26.1.1] VALYL-TRNA SYNTHETASE A:1 -- 189 A:343 -- 578
    3e-34  11%  1d2rA  [c.26.1.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    7e-32  13%  1j1uA  [c.26.1.1] TYROSYL-TRNA SYNTHETASE
    3e-29   9%  1irxA2 [c.26.1.1] LYSYL-TRNA SYNTHETASE A:3 -- 319
    1e-28  12%  1iq0A2 [c.26.1.1] ARGINYL-TRNA SYNTHETASE A:97 -- 466
    1e-21  14%  1ffyA3 [c.26.1.1] ISOLEUCYL-TRNA SYNTHETASE A:1 -- 200 A:395 -- 644
    1e-20  11%  1li5A2 [c.26.1.1] CYSTEINYL-TRNA SYNTHETASE A:1 -- 315
    1e-19  17%  1h3nA3 [c.26.1.1] LEUCYL-TRNA SYNTHETASE A:1 -- 225 A:418 -- 686
    2e-18   7%  1ileA3 [c.26.1.1] ISOLEUCYL-TRNA SYNTHETASE A:1 -- 197 A:387 -- 641
    8e-15  13%  1jeqA3 [b.131.1.1] KU70 A:254 -- 538
    1e-13  19%  1qhuA1 [b.66.1.1] PROTEIN (HEMOPEXIN) A:24 -- 215
    1e-10  22%  2np5A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:9 -- 77
    4e-09  17%  2fq4A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR, TETR FAMILY A:9 -- 77
    6e-08  17%  2g3bA1 [a.4.1.9] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR A:2
    6e-05   9%  1c4kA1 [c.23.1.4] PROTEIN (ORNITHINE DECARBOXYLASE) A:1 -- 107
    5e-04  15%  1pb6A1 [a.4.1.9] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR YCDC A:14
    7e-04  17%  2g7sA1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR, TETR FAMILY A:3 -- 76
:555

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxTNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYQGQCNLRFDDTN
1g59A2          ---------------------------VVTRIAPSPTGDPHVGTAYIALFNYAWARRNGGRFIVRIEDTD
1nzjA           -------------------------TQYIGRFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDID
1euqA1          ----------------------------------------------------------------------
1euqA2          --------TNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYKGQCNLRFDDTN
1f4lA2          -----------------------------TCALPYANGSIHLGHMLEHIQADVWVRAHGTPIMLKAQGIT
1a8hA2          -----------------------EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLAHRLDGYRTFFLTGTD
1rqgA2          -----------------------------TSALPYANGPIHAGHLAGAYLPADIFVRYLGEDVVFICGTD
1gaxA3          ------------KNPFVANPKSGKPPFVIFMPPPNVTGSLHMGHALDNSLQDALITQVVVERLLLKEGKT
1d2rA           -----------------------------IFSGIQPSGVITIGNYIGALRQFVELQHEYNCYFCIVDQHQ
1j1uA           -----------------------------AYIGFEPSGKIHLGHYLQIKKMIDLQNALLADLHAYLNQKG
1irxA2          -------------IADKIIRERGEKEKYVVESGITPSGYVHVGNFRELFTAYIVGKGYEVRHIHMWDDYD
1iq0A2          -------------------FPRRPGVVLVEHTSVNPNKELHVGHLRNIALGDAIALAYAGREVLVLNYID
1ffyA3          ---------------KALEKNKGNETFILHDGPPYANGNLHMGHALNKILKDFIVDTHGLPIEQALTKKG
1li5A2          ---------------------IHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVALGYKLKYVRNITDID
1h3nA3          -----------------KDLPGGRGKQYVLVMFPYPSGDLHMGHLKNYTMGDVLARRMQGYEVLHPMGWD
1ileA3          ----------------SVENRKGGPRYTVYEGPPTANGLPHVGHAQARSYKDLFPRYKTMRG----YYAP
1jeqA3          ----------------------------------------------------------------KMPFTE
1qhuA1          -----------------------KWFWDLTTGTKKERSWPAVGNCTSALRWLGRYYCFQGNQFLRFNPVS
2np5A1          ----------------------------------------------------------------------
2fq4A1          ----------------------------------------------------------------------
2g3bA1          ----------------------------------------------------------------------
1c4kA1          --------------------------------------------------------------------ID
1pb6A1          ----------------------------------------------------------------------
2g7sA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PVKEDIEYVDSIKNDVEWLGFHWSGDIRYSSDYFDQLHAYAVELINKGLAYVDELTPEQIREYRGTLTAP
1g59A2          RARYVPGAEERILAALKWLGLSYDEGPDRQSERLPLYQKYAEELLKRGWAYRAFETPEELEQIRK----E
1nzjA           PPREVPGAAETILRQLEHYGLHWDGDVLWQSQRHDAYREALAWLHEQGLSYYCTCTRARIQSIG-----G
1euqA1          ----------------------------------------------------------------------
1euqA2          PVKEDIEYVESIKNDVEWLGFHWSGNVRYSSDYFDQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQP
1f4lA2          PEQMIGEMSQEHQTDFAGFNISYDNYHSTSEENRQLSELIYSRLKENGFIKNRTISQLYDPEKGMFLPDR
1a8hA2          EHGETVYVSGRFKRAWDLLGIAYDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEG
1rqgA2          EHGTPISFHEQIKITFQRAKISFDFFGRELPIHYKLSQEFFLKAYENGHLVKKVTKQAYCEHDKMFLPDR
1gaxA3          RHDLGRESGGTILKQLKRLGASADWSREMDEKRSRAVRYAFSRYYHEGLAYRAPRLVNWCPRCETTLSDL
1d2rA           DPHELRQNIRRLAALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGAAAAY
1j1uA           ELDEIRKIGDYNKKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRARRSMELIAREDENPKVA
1irxA2          RFRKVPRNVPQEWKDYLGMPISEVPDPWHFMRKFEEEVEKLGIEVDLLYASELYKRGEYSEEIRLAFEKM
1iq0A2          DTGRQAARHYGLTWDGKEKYDHFAGRAYVRLHQDPEYERLQPAIEEVLHALERGELREEVNRILLAQMAT
1ffyA3          VDRKKMEQIELQKKDFRRLGVRGDFNDPYKPEYEAAQIRIFGEMADKGLIYKGKKPVYWSPSSESSLAEA
1li5A2          DKIIKRRMIAEMHKDFDALNILRPDMEPRATHHIAEIIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGV
1h3nA3          AFGLPAENIRQAKESLRLMGILYDWDRECEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLAND
1ileA3          RRAGWDTHGLPVELEVEKKLGLKSKREIEAYG--------IERFNQACRESVFTYEKEWEAFTERIAYWV
1jeqA3          KIMATPEQVGKMKAIVEKLRFTYR-SDSFENPVLQQHFRNLEALALDLMEPEQA---------------V
1qhuA1          GEVPP-GYPLDVRDY--FLSCPGRG---------------------------------------------
2np5A1          ----------------------------------------------------------------------
2fq4A1          ----------------------------------------------------------------------
2g3bA1          ----------------------------------------------------------------------
1c4kA1          AADATKFGIPVFAVTKDAQAISADELKKIFIDLEFDATVNAREIETAVNNYEDSI---------------
1pb6A1          ----------------------------------------------------------------------
2g7sA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GKNSPFRDRSVEENLALFEKMRTGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYP
1g59A2          KGGYDGRARNIPPEEA-EERARRG----EPHVIRLKVPRPGT-TEVKDELRGVVVYEIPDVVLLKSDGYP
1nzjA           IYDGHCRVLHHGPDNAAVRIRQQHPVTQFTDQLRGIIHADEK-LAREDFIIHRR------------DGLF
1euqA1          ----------------------------------------------------------------------
1euqA2          GKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYP
1f4lA2          FTPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFGFEIPNAPGKY
1a8hA2          LCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSKSRVPWGIPL
1rqgA2          FAICGRPISFRDSAHYYIKMQDFAERLKRWIEKNMVLSWIEEGLEERAITRDLNWGIPVPLDEEDMKGKV
1gaxA3          EVETCSRCGTPIE-----YAIFPQWWLRMRPLAEEVLKGLRRGDIAFVPERWKKVNMDWLENVKDWNISR
1d2rA           NTDIVPVGEDQKQHIELLAERFNKRYGELFTIPEARIPKVGARIMSLVDPTKKMS---KSDPNPKAYITL
1j1uA           EVIYPIMQV--NDIHYLGVDVAVGGMEQRKIHMLARELLPKKVVCIHNP--------VLTGLDGEGNFIA
1irxA2          EILNKYREIAKQPPLPENWWPAMVYCPEHRREAEIIEWDGGWKVKYKCPEGHEGWVDIRSGNVKLRWRVD
1iq0A2          MESDIVRAGLLQKALALLEQVFRPREGKYAGALVMDASPVIPGLEDPFFVLLRSNYYAKDIAFQFWKMGI
1ffyA3          EIEYPHDWRTKKPVIFRATPQWFASISK-----VRQDILDAIENTNFKVNWGKTRIYNMVRDRGEWVISR
1li5A2          LSRQKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECAMNCKQLGNHFDIHGGGSDLMFPHHENEIAY
1h3nA3          TPVEKRELEQWYLRITAYAERLLKDLEGLNWPEKVKAMQRAWIGRLRDWLISRQRYWGTPIPMCEAC---
1ileA3          DLEDAYATLEPTYIESIWWSLKNLFDRGLLYRDHKVVPYCPRCGTPLSSHEVALGYPHCWRCSTPLMYYA
1jeqA3          DLTLPKVEAMNKRLGSLVDEFKELVYPPDYN---------------------------------------
1qhuA1          ----------------------------------------------------------------------
2np5A1          ----------------------------------------------------------------------
2fq4A1          ----------------------------------------------------------------------
2g3bA1          ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1pb6A1          ----------------------------------------------------------------------
2g7sA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MYDFTHCISDALEGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTD
1g59A2          TYHLANVVDDHLMGVTDVIRAEEWLVSTPIHVLLYRAFGWEA-PRFYHMPLLNPDKTKISKRKS------
1nzjA           AYNLAVVVDDHFQGVTEIVRGADLIEPTVRQISLYQLFGWK----VPDYIHLPLALNALPKG--------
1euqA1          ----------------------------------------------------------------------
1euqA2          MYDFTHCISDALEGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTD
1f4lA2          FYVWLDAPIGYMGSFKNLCDKRGDSVSFDEYWKKDSTAELYHFIGKDIVYFHSLFWPAMLEGSNFRKPSN
1a8hA2          PWDENHVTYVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKILKPHAVFWPTMLKAAGIPMYRHLNVG
1rqgA2          LYVWFEAPIGYISITIEHFKRIGKPNEWKKYWLNIDGQTRVIHFIGKDNIPFHAIFWPAFLMAYGKYKDE
1gaxA3          QLWWGHQIPAWYCEDCQAVNVPRPERYLEDPTSC-EACGSPRLKRDEDVFDTWFSSALWPLSTLGWPEET
1d2rA           LDDAKTIEKKIKSAVTDSEGTIRYDKEAKPGISNLL--NIYSTLSGQSIEELERQYEGKGYGVFKADLAQ
1j1uA           VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKY--------FLEYPLTIKRPEKFGGDLTVNSYEELE-S
1irxA2          WPMRWSHFGVDFEPAGKDHLVAGSSYDTGKEIIK-EVYGKEAPLSLMYEFVGIKGQNVILLSDLYEVLEP
1iq0A2          LEGLRFRPYENPYYPGLRTSAPEGEAYTPKAEETINVVDVRQSHPQALVRAALALAGYPALAEKAHHLAY
1ffyA3          QRVWGVPLPVFYAENGEIIMTKETVNHVADLFA-------------------------------------
1li5A2          VNYWMHSGMVMVDREKMSKSLGNFFTVRDVLKYYD-----------------------------------
1h3nA3          ----------------------------------------------------------------------
1ileA3          TESWFIKNTLFKDELIRNNQEIHWVPPHIKEGR-------------------------------------
1jeqA3          ----------------------------------------------------------------------
1qhuA1          ----------------------------------------------------------------------
2np5A1          ----------------------------------------------------------------------
2fq4A1          ----------------------------------------------------------------------
2g3bA1          ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1pb6A1          ----------------------------------------------------------------------
2g7sA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPV
1g59A2          ----------HTSLDWYKAEGFLPEALRNYLCLMGFSMPDGR-EIFTLEEFIQERVSLGGPV--------
1nzjA           -------DPRPVLIAALQFLGQQAEAHWQDFSVEQI-----------LQSAVKNWRLTAVPESAIV----
1euqA1          -----------------------------------------------------------APRAMAVIDPV
1euqA2          KHVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNEN-----------
1f4lA2          LFVHGYVTVNGAKMSKSRGTHFDADSLRYYYTAKLSSRDDIDLNLEDFVQRVNADI--------------
1a8hA2          GFLLGPDGRKMSKTLGALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEAD---------------
1rqgA2          EPANEYLTLEGKKFSTSRNWVFPADYLRYYLTTIMPETRDSDFSFSDFKVRINEEL--------------
1gaxA3          EDLKAFYPGDVLVTGYDILFLWVSRMEVSGYHFMGERPFKTVL---LHGLVLDEKGQKMSKSKGNVIDPL
1d2rA           VTLRPIQERYH-----------------------------------------------------------
1j1uA           LFKNKELHPMIKILEPIRKRLY------------------------------------------------
1irxA2          GLVRRPNKEI------------------------------------------------------------
1iq0A2          ETVLLEGRQMSGAVDEVLEEATRRARAIVEEKNPDHPDKEEAARMVALG-AIRFSMVKTEPKKQIDFRYQ
1ffyA3          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1jeqA3          ----------------------------------------------------------------------
1qhuA1          ----------------------------------------------------------------------
2np5A1          ----------------AAESGLEGASVREVAKRAGVSIGAVQHHFSTKDEXFAFALRTLVDKLLARLSEV
2fq4A1          ----------------LLESGFKAVTVDKIAERAKVSKATIYKWWPNKAAVVXDGFLSAAAARLPVPD--
2g3bA1          ----------------IAQRGIRGLRVNDVAEVAGVSPGLLYYHFKDRIGLLEAALNYINDRARAYRS--
1c4kA1          ----------------------------------------------------------------------
1pb6A1          ----------------FSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLK--
2g7sA1          ----------------IIRGGYNSFSYADISQVVGIRNASIHHHFPSKSDLVCKLVSQYRQEAEAGIAEL


                         .         .         .         .         *         .         .:420
query           KLVIENYPQGESEMVTMPNHPNKPEMGSREVPFSGEIWIDRADFREEANKQYKRLVMGKEVRLRNAYVIK
1g59A2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1euqA1          KLVIENYQ-GEGEMVTMPNHPNKPEMGSRQVPFSGEIWIDRADFREEANKQYKRLVLGKEVRLRNAYVIK
1euqA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1gaxA3          EMVERYGADALRFALIYLATGGQDI------RLDLRWLEMARNF--------------------------
1d2rA           ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1iq0A2          EAL-------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1jeqA3          ----------------------------------------------------------------------
1qhuA1          ----------------------------------------------------------------------
2np5A1          ----------------------------------------------------------------------
2fq4A1          ----------------------------------------------------------------------
2g3bA1          ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1pb6A1          ----------------------------------------------------------------------
2g7sA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIHWVSAAHALPIEIRLYDRLFSVPNPGAAEDFL
1g59A2          ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1euqA1          AERVEKDAEGNITTIFCTYD-----------ADTLGVIHWVSAAHALPVEIRLYDRLFSVPNPGAADDFL
1euqA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1jeqA3          ----------------------------------------------------------------------
1qhuA1          ----------------------------------------------------------------------
2np5A1          ----------------------------------------------------------------------
2fq4A1          ----------------------------------------------------------------------
2g3bA1          ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1pb6A1          ----------------------------------------------------------------------
2g7sA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SVINPESLVIKQGYGEPSLKAAVAGKAFQFEREGYFCLDSRYATADKLVFNRTVGLRDTxxxxxx
1g59A2          -----------------------------------------------------------------
1nzjA           -----------------------------------------------------------------
1euqA1          SVINPESLVIKQGFAEPSLKDAVAGKAFQFEREGYFCLDSRHSTAEKPVFNRTVGLRDT------
1euqA2          -----------------------------------------------------------------
1f4lA2          -----------------------------------------------------------------
1a8hA2          -----------------------------------------------------------------
1rqgA2          -----------------------------------------------------------------
1gaxA3          -----------------------------------------------------------------
1d2rA           -----------------------------------------------------------------
1j1uA           -----------------------------------------------------------------
1irxA2          -----------------------------------------------------------------
1iq0A2          -----------------------------------------------------------------
1ffyA3          -----------------------------------------------------------------
1li5A2          -----------------------------------------------------------------
1h3nA3          -----------------------------------------------------------------
1ileA3          -----------------------------------------------------------------
1jeqA3          -----------------------------------------------------------------
1qhuA1          -----------------------------------------------------------------
2np5A1          -----------------------------------------------------------------
2fq4A1          -----------------------------------------------------------------
2g3bA1          -----------------------------------------------------------------
1c4kA1          -----------------------------------------------------------------
1pb6A1          -----------------------------------------------------------------
2g7sA1          -----------------------------------------------------------------