[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF68527.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1klxA.bssp"
#ERROR : Can't open dsspfile "1h3iA1.bssp"
#ERROR : Can't open dsspfile "1ouvA.bssp"
#ERROR : Can't open dsspfile "1zbpA1.bssp"
#ERROR : Can't open dsspfile "1vjgA.bssp"
#ERROR : Can't open dsspfile "1vefA1.bssp"
#ERROR : Can't open dsspfile "1h3iA1.bssp"

## Summary of PDB Search
:722
    3e-15  23%  1klxA  [a.118.18.1] CYSTEINE RICH PROTEIN B
    8e-12  13%  1h3iA1 [b.76.2.1] HISTONE H3 LYSINE 4 SPECIFIC METHYLTRANSFERASE
    2e-06  16%  1ouvA  [a.118.18.1] CONSERVED HYPOTHETICAL SECRETED PROTEIN
    3e-04   7%  1zbpA1 [e.61.1.1] HYPOTHETICAL PROTEIN VPA1032 A:2 -- 265
    6e-04  10%  1vjgA  [c.23.10.6] PUTATIVE LIPASE FROM THE G-D-S-L FAMILY
    6e-04  12%  1vefA1 [c.67.1.4] ACETYLORNITHINE/ACETYL-LYSINE AMINOTRANSFERASE
    6e-07  14%  1h3iA1 [b.76.2.1] HISTONE H3 LYSINE 4 SPECIFIC METHYLTRANSFERASE(query 196->309)
:722

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1klxA           ----------------------------------------------------------------------
1h3iA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
1vefA1          ----------------------------------------------------------------------
1h3iA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1klxA           ----------------------------------------------------------------------
1h3iA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
1vefA1          ----------------------------------------------------------------------
1h3iA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGYTNEENFANRQRVS
1klxA           ----------------------------------------------------------------------
1h3iA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
1vefA1          ----------------------------------------------------------------------
1h3iA1          -------------------------------------------------------GGVLQGTYVDGELNG


                         .         .         .         +         .         .         .:280
query           VFKSFYESGNLKSIYHYNAQNKRDGKAETYFDEKDKIAETLTFKDGQPEGEYIVYHENGAVESKRYFAQG
1klxA           ----------------------------------------------------------------------
1h3iA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
1vefA1          ----------------------------------------------------------------------
1h3iA1          PAQEYDTDGRLIFKGQYK-DNIRHGV-CWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTLYGKFIDG


                         .         *         .         .         .         .         +:350
query           KIKDGECPHFYDNGVLKQKHSYLNQKLEGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1klxA           ----------------------------------------------------------------------
1h3iA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
1vefA1          ----------------------------------------------------------------------
1h3iA1          EMIEGKLATLMSTEEGRPHFELMPGNSVY-----------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGRKHGAVKEWFSNGKPASS
1klxA           ----------------------------------------------------------------------
1h3iA1          ---------------------------------------------------DALQGQGVYTYEDGGVLQG
1ouvA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
1vefA1          ----------------------------------------------------------------------
1h3iA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KMYKHDVLDGDFEKWYENGHRESVYPYKNGMLNGDAKHWNEQGKLTYTTEYKDDKKQGADRRWSERTGKL
1klxA           ----------------------------------------------------------------------
1h3iA1          -TYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERT
1ouvA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
1vefA1          ----------------------------------------------------------------------
1h3iA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           VEEVMFANDERNGLKREFNDRTGKVLSALPYVDGDKEGTEEAYDEDGIKYIRCYHNDEELSELYAPTDVT
1klxA           ----------------------------------------------------------------------
1h3iA1          ALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPGNSVYH-------------------------------
1ouvA           -------------------------------------------------DGKVVTRDFKKAVEYFTKACD
1zbpA1          ----------------------------------------------------------------------
1vjgA           ---------------------------------------------------------VNANKKGYDVTYY
1vefA1          -------------LLEAEKTLDSGVYNKHDLLIVRGQG-ARVWDAEGNEYIDCVGGYGVANLGHGNPEVV
1h3iA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           NKAKQGDSTAQYHLGKYEFECTNYDAAMKWLTQSAEQNHPGALLFLAYAYNDGDGVAQDSKKYLSYLFKA
1klxA           ----------------------DLKKAIQYYVKACELNEMFGCLSLVSNS------QINKQKLFQYLSKA
1h3iA1          ----------------------------------------------------------------------
1ouvA           LNDGDGCTILGSLYDAGRGTPKDLKKALASYDKACDLKDSPGCFNAGNMYHHGEGATKNFKEALARYSKA
1zbpA1          ------DASLRSSFIELLCIDGDFERADEQLXQSIKLEYLPGASQLRHLVKA---AQARKDFAQGAATAK
1vjgA           NLGIRRDTSSD------------IAKRWLQEVSLRLHKEYNSLVVFSFGLNDRVSIAETIKNTREILTQA
1vefA1          EAVKRQAETLMAMFYRTLTAILPPELNRVFPVNSGTEANEAALKFAR-AHTGRKKFVAAMRGFSGRTMGS
1h3iA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           AELGESDAQLEVGYLNLIGEGMPKNLPEAYKWIKKSADQGNAQAHYNLGLMYRNGDGVEKDLNKAKLHLT
1klxA           CELNSGNGCRFLGDFYENGKYVKKDLRKAAQYYSKACGLNDQDGCLILGYKQYAGKGVVKNEKQAVKTFE
1h3iA1          ----------------------------------------------------------------------
1ouvA           CELENGGGCFNLGAMQYNGEGVTRNEKQAIENFKKGCKLGAKGACDILKQLKIKV---------------
1zbpA1          VLGENEELT---KSLVSNLSXVSQDYEQVSELALQELRQEKGFLANDTSFSDV-----------------
1vjgA           KKLYPVLXISPAPYIEQQDPGRRRRTIDLSQQLALVCQDLDVPYLDVFPLLEKPSVWLHEAKANDGVHPQ
1vefA1          LSVT------------------------------------------------------------------
1h3iA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           AAVKGGVKPALAALxxxxxxxx
1klxA           KACRLGSEDACGIL--------
1h3iA1          ----------------------
1ouvA           ----------------------
1zbpA1          ----------------------
1vjgA           AG--------------------
1vefA1          ----------------------
1h3iA1          ----------------------