[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF68745.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1deoA.bssp"
#ERROR : Can't open dsspfile "3dc7A1.bssp"
#ERROR : Can't open dsspfile "3bzwA1.bssp"
#ERROR : Can't open dsspfile "1yzfA1.bssp"
#ERROR : Can't open dsspfile "2hsjA1.bssp"
#ERROR : Can't open dsspfile "1vjgA.bssp"
#ERROR : Can't open dsspfile "1escA.bssp"

## Summary of PDB Search
:408
    8e-14  19%  1deoA  [c.23.10.4] RHAMNOGALACTURONAN ACETYLESTERASE
    2e-13  17%  3dc7A1 [c.23.10.9] PUTATIVE UNCHARACTERIZED PROTEIN LP_3323 A:18 --
    2e-12  16%  3bzwA1 [c.23.10.9] PUTATIVE LIPASE A:38 -- 285
    5e-09  17%  1yzfA1 [c.23.10.5] LIPASE/ACYLHYDROLASE A:1 -- 195
    2e-05  21%  2hsjA1 [c.23.10.3] PUTATIVE PLATELET ACTIVATING FACTOR A:1 -- 211
    4e-05  17%  1vjgA  [c.23.10.6] PUTATIVE LIPASE FROM THE G-D-S-L FAMILY
    8e-05  14%  1escA  [c.23.10.1] ESTERASE
:408

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1deoA           ----------------------------------------------------------------------
3dc7A1          ----------------------------------------------------------------------
3bzwA1          ----------------------------------------------------------------------
1yzfA1          ----------------------------------------------------------------------
2hsjA1          ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
1escA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHPKPKNISLG
1deoA           ----------------------------------------------------------------------
3dc7A1          ------------------------------------------------------------HVSFKRP---
3bzwA1          ---------------------------------------------------------------------W
1yzfA1          ----------------------------------------------------------------------
2hsjA1          ----------------------------------------------------------------------
1vjgA           ----------------------------------------------------------------------
1escA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DITRLVFFGDSLSDSLGRMFEKTHHILPSYGQYFGGRFTNGFTWTEFLSSPHFLGKEMLNFAEGGSTSAS
1deoA           --TTVYLAGDSTMAKNG-----------------GGSGTNG--WGEYLA--SYLSATVVNDAVAGRSAR-
3dc7A1          -----AWLGDSITA---------------------NNGLATVHYHDILAA-DWDVERSDNLGISGSTIGS
3bzwA1          QGKKVGYIGDSIT-------------------DPNCYGDNIKKYWDFL--KEWLGITPFVYGISGRQW--
1yzfA1          -MRKIVLFGDSITAGYL---------DEAVSPVLVDL------VKRDIAAMGLEEVAVINAGMPGDTTE-
2hsjA1          ---NILFIGDSI--------------------------VEYYPLQELFGT----SKTIVNRGIRGYQT--
1vjgA           ---RICFVGDSFVNGTG----------DPECLGWTGRVCVNANK-------KGYDVTYYNLGIRRDTSS-
1escA           DPVPTVFFGDSYTA--------NFGIAPVTNQDSEWCFQAKENYTRSLADKGITLDVQADVSCGGALIHH


                         .         .         .         +         .         .         .:280
query           YSCFNCIGDFVSNTDRQVASYTPSHQDLAIFLLGANDYMTLHKDNVIMVVEQQIDDIEKIISGGVNNVLV
1deoA           --------SYTREGRFENIADVVTAGDYVIVEFGHNDGGSLSTDNGRTDCSGTGAEVCYSVYDGVNETIL
3dc7A1          RYDAXAV-------RYQAIPEDA---DFIAVFGGVNDYGRDQPLGQYGTFYGALXXLLTGLQTNWPTKLF
3bzwA1          -------DDVPRQAEKLKKEH-GGEVDAILVFXGTNDYVTRKKRTPVXTQDTYRGRINIGITFPDKQIVL
1yzfA1          --------DGLKRLNKEVLIEKP---DEVVIFFGANDASLDRNITVATFRENLETMIHEIGSEKVILITP
2hsjA1          -------GLLLENLDAHLYGGAV---DKIFLLIGTND---IGKD---VPVNEALNNLEAIIQSVARDYPL
1vjgA           --------DIAKRWLQEVSLRLHKEYSLVVFSFGLNDTTLENGKPRVSIAETIKNTREILTQAKKLYPVL
1escA           FWEKQELPFGAGELPPQQDAL-KQDTQLTVGSLGGNTLGFNRILKQCSDELRKPSLL--PGDPVDGDEPA


                         .         *         .         .         .         .         +:350
query           MGIPDLSLTPYGKHSDEKRKLKDESIAHNALLKTNVEELKEKYPQHKICYYETADAFKVIMEAASNIGYD
1deoA           T--------------------------FPAYLENAAKLFTAKGAKVILSSQTPNNPWEYAELAAEVAGVE
3dc7A1          ISAIHIGSDFGGSFSAVTNGLGYRQSDYEAAIA----------------------------QXTADYGVP
3bzwA1          LTPLHRSLANFG--DKNVQPDESYQNGCGEYIDAYVQAIKEAGNIWGIPVI---DFNAVTGXNPXVEEQL
1yzfA1          PYADSGRRPERP----------------QTRIKELVKVAQEVGAAHNLPVIDLYKAM-------------
2hsjA1          TEIKLLSILPVNEREEYQQAVYIRS---NEKIQNWNQAYQELASAYXQVEF--VPVFDCLTDQAGQL---
1vjgA           XISPAPYIEQQDP-------------GRRRRTIDLSQQLALVCQDLDVPYLDVFPLLE------------
1escA           AKCGEFFGTGDGKQWLDD-QFERVGAELEELLDRIGYFAPDAKRVLVGYPRLVPEDTTKCLTAAPGQDVD


                         .         .         .         .         *         .         .:420
query           TENPYTHHGYVHVPGAKDPQLDICPQYVFNDLVHPTQEVHHCFAIMLESFIAHHYxxx
1deoA           YVDHWSYVDSIYETLGNATV----NSYFPIDHTHTSPAGAEVVAEAFLKAVVCTG---
3dc7A1          HLSLYRDAGX-------TFAIPAQAAIYSVDTLHPNNAGHRVIARKLQSFLDSHF---
3bzwA1          I----------------------YFYDAGYDRLHPDTKGQERXARTLXYQL-------
1yzfA1          ------------------TVYPGTDEFLQADGLHFSQVGYELLGALIVREIK------
2hsjA1          ----------------------------------------------------------
1vjgA           ------------------KPSVWLHEAKANDGVHPQAGGYTEFARIVENWDA------
1escA           LYAGTGANTDGADRGIGGLLEDSQLGTKIPWYAHPNDKGRDIQAKQVADKI-------