[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for sent8:ACF68874.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1j1lA.bssp"
#ERROR : Can't open dsspfile "1tq5A1.bssp"
#ERROR : Can't open dsspfile "1gqgA.bssp"
#ERROR : Can't open dsspfile "2atfA1.bssp"
#ERROR : Can't open dsspfile "1j3pA.bssp"
#ERROR : Can't open dsspfile "2gm6A1.bssp"
#ERROR : Can't open dsspfile "1fi2A.bssp"
#ERROR : Can't open dsspfile "2f4pA1.bssp"
#ERROR : Can't open dsspfile "1j58A.bssp"
#ERROR : Can't open dsspfile "1ey2A.bssp"
#ERROR : Can't open dsspfile "1pmiA.bssp"
#ERROR : Can't open dsspfile "1o4tA.bssp"
#ERROR : Can't open dsspfile "1sq4A.bssp"

## Summary of PDB Search
:286
    1e-66  32%  1j1lA  [b.82.1.12] PIRIN
    8e-45  26%  1tq5A1 [b.82.1.12] PROTEIN YHHW A:1 -- 231
    4e-16   9%  1gqgA  [b.82.1.5] QUERCETIN 2,3-DIOXYGENASE
    4e-14  10%  2atfA1 [b.82.1.19] CYSTEINE DIOXYGENASE TYPE I A:5 -- 190
    2e-12   9%  1j3pA  [b.82.1.7] PHOSPHOGLUCOSE ISOMERASE
    2e-12  14%  2gm6A1 [b.82.1.19] CYSTEINE DIOXYGENASE TYPE I A:11 -- 202
    3e-09  16%  1fi2A  [b.82.1.2] OXALATE OXIDASE
    1e-04  15%  2f4pA1 [b.82.1.9] HYPOTHETICAL PROTEIN TM1010 A:2 -- 135
    1e-04  10%  1j58A  [b.82.1.2] YVRK PROTEIN
    2e-04   8%  1ey2A  [b.82.1.4] HOMOGENTISATE 1,2-DIOXYGENASE
    2e-04  15%  1pmiA  [b.82.1.3] PHOSPHOMANNOSE ISOMERASE
    3e-04  19%  1o4tA  [b.82.1.9] PUTATIVE OXALATE DECARBOXYLASE
    4e-04  20%  1sq4A  [b.82.1.11] GLYOXYLATE-INDUCED PROTEIN
:286

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKQITGVYTAPRPHWVGDGFPVRSLFSYQSHAQQLSPFLLLDYAGPHTFTPGNEKRGVGEHPHRGFETVT
1j1lA           -KKVTLSVLSREQS-EGVGARVRRSIGRPEL-KNLDPFLLFDEFKG------GRPGGFPDHPHRGFETVS
1tq5A1          -----------------------------------------------------AGQGFGTHPHKDXEILT
1gqgA           ----------HARAVTVDTQLYRFYVTGPSSGYAFTLMGTNAPHSDALGVL--------PHIHQKHYENF
2atfA1          -QAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLXIL----CWGEG---HGSSIHDHTDSHCFL
1j3pA           MKGYFIDEEAWKKMVEEGDPVVYEVYAIEQEEKEGDLNFATTVLYPGKVGNEFFMTKGHYHSKIDRAEVY
2gm6A1          ------------ARLVARDDWLPDAFAQ-PHPEYYQQXLLHCDSAERVWGPGQ---RTPIHDHTVWGLIG
1fi2A           -FLFSSKLTKAGNTSTPNGSAVTELDVA-EWPGTNTLGVSMNRV---DFAPGGT---NPPHIHPRATEIG
2f4pA1          VDDIFERGSKGSSDFFTGNVWVKXLVTDENGVFNTQVYDV-------VFEPGAR---THWHSHPGGQILI
1j58A           ------------------------------------KVSKTIASALVTVEPGAX---RELHWHPNTHEWQ
1ey2A           -----------------------------------------------LCNTSXE---NRCFYNSDGDFLI
1pmiA           ----------LQEFPRSKGDAVKSVLYDPPIAEFSVLQTIFDK-SKGGKQV--------IEGLNGPSIVI
1o4tA           ---------ISNMRGGKGEVEMAHLLSKEAMHNKARLFARMKLP-PGSSVG--------LHKHEGEFEIY
1sq4A           -----------------------------------------------ELAPN-GGSDKPEQDPNAEAVL-


                         .         .         *         .         .         .         .:140
query           IVYSGEVEHRDSTGRGGVIGPGDVQWMTAGAGILHEEFHSDAFTRRGGELEMVQLWVNLPMKDKMTPPGY
1j1lA           YLLEGGXAHEDFCGHTGKXNPGDLQWXTAGRGILHAEXPCS-----EEPAHGLQLWVNLRSSEKXVEPQY
1tq5A1          YVLEGTVEHQDSXGNKEQVPAGEFQIXSAGTGIRHSEYNPSS----TERLHLYQIWIXP--EENGITPRY
1gqgA           YCNKGSFQLWAQSGNETVLSSGDYGSVPRNTFQIQDPDTEMTGVIVPGGFEDLFYYLGTNATDTTHTPYI
2atfA1          KLLQGNLKETLIKKSERTLRENQCAYINDSIGLHRVENVSH-----TEPAVSLHLYSPPFDTCHAFDQRT
1j3pA           FALKGKGGLQTPEGEARFIEMEPGTIVYVPPYWAHRT-------INTGDKPFIFLALYPADAGHDYGTIA
2gm6A1          XLRGAEYSRPVLHGEPTRLEPGHVEAVSPTVGDIHRVHNAYD----DRVSISIHVYGANIGGVRRSKPFI
1fi2A           MVMKGELLSLDSGNKLYSRVVRAGETFVIPRGLMH------FQFNVGKTEAYMVVSFNSQNPGIVFVPLT
2f4pA1          VT-RGKGFYQERGKPARILKKGDVVEIPPN----------------------------------------
1j58A           YYISGKARVFASDGHARTFNYQAGDVGYVPFAXGHYVENIG-----DEPLVFLEIF-KDDHYADVSLNQW
1ey2A           VPQKGNLLIYTE-FGKXLVQPNEICVIQRG----------------------------------------
1pmiA           AT-NGKGTIQITGDDSTKIDTGYVFFVAPG----------------------------------------
1o4tA           YILLGEGVFHD-NGKDVPIKAGDVCFTD--SGESHSIENTG-----NTDLEFLAVIILL-----------
1sq4A           FVVEGELSLTLQ-GQVHAXQPGGYAFIPPGA---------------------------------------


                         +         .         .         .         .         *         .:210
query           QSITHDVIPTVTLPDNAGVVRVIAGRYEETKGPAHTFSPLNVWDMRLQRNRQLTLAQPEGWSTALVVLKG
1j1lA           QELKSEEIPKPS--KDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISG
1tq5A1          EQRRFDAVQG----------KQLVLSPDARDGSLKVHQDXELYRWALLKDEQSVHQIAAERRVWIQVVKG
1gqgA           PSSTLQSFDVYAELSFTPRTDTVNGTAPANTVWHTGANALAGDPYFIANGWGPKYLNSQYGYQIVAPFVT
2atfA1          GHKNKVTXT-------------------------------------------------------------
1j3pA           EKGFSKIVVEENGK--------------------------------------------------------
2gm6A1          SGYSNPYLPNP-----------------------------------------------------------
1fi2A           LFGSDPPIPTPVLTKALRVEAGVVEL--------------------------------------------
2f4pA1          ----------------------------------------------------------------------
1j58A           LAXLPETFVQAHLDLGKDFTDVLSKEKHP-----------------------------------------
1ey2A           ----------------------------------------------------------------------
1pmiA           ----------------------------------------------------------------------
1o4tA           ----------------------------------------------------------------------
1sq4A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NITVNGTTPVNEAQLVVLSQQGKTLHLEASSDASVLLLSGEPLNEPIVGYGPFVMNTKQEIAEAVRDFNS
1j1lA           DVYIGPQQKIEPHHTAVLEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVXNTNEEISQAILDFRN
1tq5A1          NVTINGVKASTSDGLAIWDEQA--ISIHADSDSEVLLFDLPPV---------------------------
1gqgA           ATQAQD----------------------------------------------------------------
2atfA1          ----------------------------------------------------------------------
1j3pA           ----------------------------------------------------------------------
2gm6A1          ----------------------------------------------------------------------
1fi2A           ----------------------------------------------------------------------
2f4pA1          ----------------------------------------------------------------------
1j58A           ----------------------------------------------------------------------
1ey2A           ----------------------------------------------------------------------
1pmiA           ----------------------------------------------------------------------
1o4tA           ----------------------------------------------------------------------
1sq4A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GRFGxx
1j1lA           AKNG--
1tq5A1          ------
1gqgA           ------
2atfA1          ------
1j3pA           ------
2gm6A1          ------
1fi2A           ------
2f4pA1          ------
1j58A           ------
1ey2A           ------
1pmiA           ------
1o4tA           ------
1sq4A           ------